KEGG   Streptococcus macedonicus: SMA_1525Help
Entry
SMA_1525          CDS       T01674                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
smn  Streptococcus macedonicus
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:smn00001]
   00620 Pyruvate metabolism
    SMA_1525 (ppc)
  Energy metabolism
   00680 Methane metabolism
    SMA_1525 (ppc)
Enzymes [BR:smn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SMA_1525 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1499995..1502820)
Genome map
AA seq 941 aa AA seqDB search
MTIKKLENNSTQSIITEEVKILKGLLDEITHQMVGDEVFAKIQNIVELSASDEYVKLEKL
VVQLTNDEMVVVSRYFSILPLLINISEDVDFAYEINYQNNTNQDYLGKLSLTVDMVSESE
NSKEILENVNVVPVLTAHPTQVQRKTVLELTNHIHDLLRKYRDVRAGVVNRDKWYTDLRR
YIEIIMQTDIIREKKLKVKNEITNVMEYYNTSLIQAITKLTSEYKRLAAEKGIDLENPKP
ITMGMWIGGDRDGNPYVTAETLRLSATVQSEVIINYYIEKLTALYRTFSLSTTLTNISPE
VEKLAELSSDKSIYRENEPYRKAFNYIQSKLIQTLIELKANTAISQGVLEGSNNISSDVC
TSTKNAGVITKYLQTKFSKVSSELQEEIPSYKTAKEFKDDLFIIKQSLLDNGDDALLTGD
FSELLQAVDVFGFYLAMIDMRQDSSVNEACVAELLKSANIIEDYSSLSEEEKVKVLLKEL
QEDPRTLSSTNAEKSEQLQKELAIFQTARYLKDKLGDEVIKQHIISHTESVSDMFELAIM
LKEVGLLDNQTARVQIVPLFETIEDLENSRAIMEEYLDYDIVRRWVSASKGYQEIMLGYS
DSNKDGGYLSSVWTLYKAQNELTRIGSERGIKVTFIHGRGGTVGRGGGPSYEAITSQPFG
SIKDRIRLTEQGEIIENKYGNKDVAYYNLEMLVSATIDRIVTRMITNPDEIDDFRATMDG
IVTYSNGVYRDLVFGNPHFYDYFFEATPIKEVSSLNIGSRPAARKTITEISGLRAIPWVF
SWSQSRIMFPGWYGVGSAFKNFIDAEEGNLAKLQHMYEKWPFFHSLLSNVDMVLSKSNMN
IAFQYAQLAESEEVRDVFNTILDEWQLTKNVILAIEKHQDLLEENPSLKASLDYRLPYFN
VLNYIQIELIKRLRHEELDEDYEKLIHTTINGIATGLRNSG
NT seq 2826 nt NT seq  +upstreamnt  +downstreamnt
gtgacaatcaaaaaactggagaacaatagcacccagtcgattattaccgaggaagtcaaa
atactaaaaggcttgcttgatgagataactcatcaaatggttggtgatgaggtgtttgcc
aaaattcaaaacattgttgaattgtcagcaagtgatgaatatgtcaaacttgaaaaatta
gtagttcaattaaccaacgatgaaatggttgtagtgtctcgttatttttcaattttgcca
cttttaataaacatttcagaagacgttgattttgcttatgaaatcaattaccaaaataat
actaatcaagattatcttggtaaactctctttaaccgtagatatggtttcagaaagcgaa
aactctaaagaaatccttgaaaatgtcaatgttgtgcctgtattaacagctcaccctaca
caagttcaacgtaagacagtcctcgaattgacaaatcacattcatgaccttttacgtaaa
taccgcgatgtcagagcgggtgttgtgaaccgtgacaaatggtacactgatttgcgccgt
tacattgaaatcatcatgcaaacggacattattcgtgagaaaaaactgaaggtaaaaaat
gaaattaccaacgttatggagtattacaatacatccttaattcaagcgattaccaagttg
acttcagagtacaaacgcttagcagctgaaaaaggcatcgacctagaaaatccaaaacct
atcacaatgggaatgtggattggtggtgaccgtgacggtaacccatacgtaacagctgaa
acacttcgtttgtcagcaacggtccaaagcgaagtcatcattaactactacatcgaaaaa
ttaacagctctttatcgcacattctcactttcaacaaccttgacaaatattagtccagaa
gttgaaaaattagcagaattgtcaagcgataaatctatctaccgtgaaaatgaaccttat
cgtaaggcatttaactatattcaatcaaaattaattcaaaccttaatcgaattaaaagct
aacacagccatttctcaaggtgttttggaaggtagcaacaacatcagttcagatgtttgc
acaagcactaaaaacgctggtgtcattacaaaatacttacaaacaaaattctctaaagtt
tcatcagaacttcaagaagaaattccaagctataaaacagccaaagaatttaaagatgat
ttgtttattatcaaacaatcattgcttgacaatggtgatgatgcgctcttgacaggtgat
tttagcgaattgcttcaagcagttgatgtctttggattctatcttgcaatgattgatatg
cgtcaagattcaagcgttaacgaagcttgtgttgcagaattgttgaaatcagctaatatc
attgaggattacagctcactttcagaagaagaaaaagtaaaagttcttctcaaagaattg
caagaagacccacgtacgttgtcatcaacaaatgctgaaaaatcagaacaacttcaaaaa
gaattagcaatcttccaaacagctcgttaccttaaagataaattaggtgacgaagtcatt
aaacaacacattatttcacatactgaaagtgtttctgatatgtttgagttggctatcatg
cttaaagaagtcggacttcttgataaccaaacagcgcgtgttcaaattgtgccactcttt
gaaacaatcgaggaccttgaaaattcacgtgctatcatggaagaatatcttgattatgat
attgttcgtcgctgggtttcagctagcaaaggttaccaagaaattatgcttggttactca
gacagtaacaaagacggtggttacttatcatctgtttggacactttataaagctcaaaat
gaattgactcgtattggttcagaacgtggtattaaagtgacattcattcacggtcgtggt
ggtactgttggtcgtggtggtggtccatcatatgaagctatcacatcacaaccattcggt
tcaatcaaagatcgtattcgtcttactgagcaaggtgaaatcattgaaaataaatacggc
aataaagacgttgcttattacaaccttgaaatgttggtttcagcaactatcgatcgtatc
gtgacacgtatgattacaaatccagatgaaattgatgatttccgtgcaacaatggacggc
attgtcacttactcaaatggtgtttatcgtgatttagtatttggtaatccacatttctat
gattacttctttgaagcaacaccaatcaaggaagtatcaagcttgaacattggttcacgt
ccagctgctcgtaaaacaatcacagaaatttcaggtctccgtgcaatcccttgggtattc
tcatggtcacaaagccgtatcatgttcccaggttggtatggtgtcggttcagcattcaag
aactttattgacgctgaagaaggaaacttggcaaaacttcaacatatgtatgaaaaatgg
ccatttttccattcacttctttcaaatgttgatatggttctctctaaatcaaatatgaac
attgctttccaatatgctcaattggcagaaagcgaagaagtacgcgatgtctttaatact
atccttgacgaatggcaattgactaaaaatgttattttagcaatcgaaaaacaccaagat
ttgttggaagaaaatccttcgcttaaagcaagcttagattaccgcttgccatacttcaac
gttttgaactacattcaaattgagttgataaaacgtttacgtcatgaagaattggatgag
gattacgaaaaactcattcacacaactatcaacggtattgccacaggattgcgtaattct
ggctaa

DBGET integrated database retrieval system