KEGG   Streptococcus macedonicus: SMA_1798Help
Entry
SMA_1798          CDS       T01674                                 

Gene name
alr
Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
smn  Streptococcus macedonicus
Pathway
smn00473  D-Alanine metabolism
smn01100  Metabolic pathways
smn01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:smn00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    SMA_1798 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    SMA_1798 (alr)
Enzymes [BR:smn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     SMA_1798 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:smn01011]
 Precursor biosynthesis
  Racemase
   SMA_1798 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: CCF03089
UniProt: H2A8I8
LinkDB All DBs
Position
complement(1744346..1745452)
Genome map
AA seq 368 aa AA seqDB search
MISSLHRPTKAVIDLDAICQNIDAVKANIPQDKKAFAVVKANAYGHGATNVAQAIHHLVD
GFCVSNIDEALELREAGIEETILILGVIMPDEVALARDYHVTLTVASQEWLDLANEQGIS
LAGLDVHLKVDSGMGRIGVRSLDEAENVIANLKKAGANVEGIFTHFATADEADDTKFNEQ
LEFFTNLVNNLSDKPGIVHASNSATSIWHSETIFNLVRLGIVMYGLNPSGTELDLPYPLK
PALSLESSLVHVKMIPAGATVGYGATYTAQKEEYIATVPIGYADGWTRDLQGFSVLVNGE
FCEIVGRVSMDQITIRLPEKLTIGTKVTLIGQEGDKVISATDLAQKRGTINYEVLCLLSD
RIPRVYSK
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgatttcaagtttacacagaccaacaaaggctgtcattgatttagatgctatttgtcaa
aatattgatgcggttaaagccaatataccacaagataaaaaagcttttgcagttgttaaa
gccaatgcttatggacacggtgccacaaacgtagcgcaagctattcatcatcttgtggat
ggattctgtgtgtcaaatattgatgaagctttggaattacgtgaagcaggtattgaggaa
acaatccttattttaggtgttattatgcctgatgaggtggctttggcgcgtgattaccat
gttactttgacagttgctagtcaagaatggcttgatttggcaaatgaacaaggtattagc
ttagctggtttggacgttcacttgaaagtggattctggtatggggcgaatcggtgtgcgc
agtcttgatgaagcagaaaatgtgattgcgaatttgaaaaaagctggggctaacgttgaa
ggtatctttacgcattttgcaacagcagacgaagctgacgatacgaaattcaatgaacag
ttggaattctttacgaatttggttaacaatttgagcgacaagcctggcattgtccatgct
agtaattcagcaacaagtatttggcatagtgaaactatttttaaccttgttcgacttgga
attgtcatgtatggattgaatccaagtggaacagagcttgatttgccttatccgcttaaa
ccagcgcttagtttggaatcatcattggttcatgttaagatgattcctgctggtgcaacg
gttggctacggtgcgacctatactgctcaaaaagaggaatatatcgcgactgttccaatc
ggttacgcagacggttggacacgtgatttacaaggtttttcagtgcttgtgaatggtgaa
ttttgtgaaatcgttggacgcgtgtcaatggatcaaattaccattcgcttgccagaaaaa
cttacaatcggaacgaaagttactttgattggtcaagagggcgataaggttatttcagcg
acagatttggctcaaaaacgtggcacaatcaattatgaagttctttgtctattgagtgac
cgtattccacgtgtttattcaaaataa

DBGET integrated database retrieval system