KEGG   Selaginella moellendorffii: SELMODRAFT_403348Help
Entry
SELMODRAFT_403348 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
smo  Selaginella moellendorffii
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SELMODRAFT_403348
Enzymes [BR:smo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     SELMODRAFT_403348
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 204 aa AA seqDB search
MFAGKTTVLLQRIQAEADAGRRVALVKSDKDTRYGLGCIVSHSGKKMHCAAVASLSDFKS
HKPELYAQAEIIGIDEAQFFDDLLSFCQSAADWDGKTLIVAGLDGDFLRQRFGSALDLVP
LADSVTKLSSRCEICGRAAAFTFRKTDDRRKEVIGGADIYMPVCRKHYVNGQFAMEAARS
VVLESHSPQRDPCSSSPERKLAIG
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgtttgctgggaagaccacggtgctgctccagaggattcaagcggaggccgatgctgga
aggagagtcgccttggtgaaatcggacaaggacacaagatatggcctcggctgcatcgtc
tcgcacagcggcaaaaagatgcactgtgccgccgttgcatcgctctccgacttcaagtca
cacaagcccgagctctacgcacaggccgagatcatcggcattgacgaggcgcagttcttc
gacgatctcttgagcttctgccagtcggcggccgactgggacggcaaaactctcatcgtt
gctgggctggacggcgatttcttgaggcagcgcttcggctcggcgctggatctcgtcccc
ctggcggactccgtgaccaagctctcgtcgaggtgtgagatttgcggccgggccgcggca
ttcacgtttcgaaagacggacgatcgacgcaaggaggtgatcggcggggcggacatctac
atgcccgtgtgtaggaagcactacgtgaacggacagttcgccatggaagccgcgcgaagt
gtggttctggaatcccactcgccgcaacgcgacccttgttcgtcctcgccagagagaaag
ctcgcgattggctaa

DBGET integrated database retrieval system