KEGG   Sordaria macrospora: SMAC_05035Help
Entry
SMAC_05035        CDS       T01610                                 

Gene name
sod1
Definition
(RefSeq) SOD-1 superoxide dismutase (Cu-Zn)
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
smp  Sordaria macrospora
Pathway
Peroxisome
Brite
KEGG Orthology (KO) [BR:smp00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    SMAC_05035 (sod1)
Enzymes [BR:smp01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SMAC_05035 (sod1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
AA seq 154 aa AA seqDB search
MVKAVAVLRGDSNVKGTVIFEQESESAPTTITYDISGNDPNAKRGFHIHTFGDNTNGCTS
AGPHFNPRGTTHGNRTDEVRHVGDLGNLETDAQGNAKGSVTDNLVKLIGPESVIGRTVVV
HAGTDDLGKGGNEESLKTGNAGPRPACGVIGISQ
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaggctgtcgctgttctccgtggtgactctaacgtcaagggcaccgtgatcttc
gagcaggagtccgagtccgctcccaccaccatcacctacgacatctccggcaacgacccc
aacgccaagcgtggcttccacatccacaccttcggtgacaacaccaacggctgcacctct
gccggccctcacttcaacccccgtggcaccacccacggcaaccgcaccgacgaggtccgc
cacgtcggtgatctcggcaacctcgagaccgatgctcagggtaacgccaagggctccgtg
actgacaacctcgtcaagctcatcggccccgagtccgtcattggccgcaccgtcgtcgtc
cacgccggcactgacgaccttggcaagggtggcaacgaggagtccctcaagactggcaac
gccggtccccgccccgcctgcggcgtcattggtatctcccagtaa

DBGET integrated database retrieval system