KEGG   Sinorhizobium meliloti BL225C: SinmeB_0751Help
Entry
SinmeB_0751       CDS       T01884                                 

Definition
(GenBank) Alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:smq00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    SinmeB_0751
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    SinmeB_0751
Enzymes [BR:smq01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     SinmeB_0751
Peptidoglycan biosynthesis and degradation proteins [BR:smq01011]
 Precursor biosynthesis
  Racemase
   SinmeB_0751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(792014..793153)
Genome map
AA seq 379 aa AA seqDB search
MQSPEFLSASSRLTVDLTALADNWRAMNERSGKARAAAVLKADAYGLGVVHAAPALYAAG
ARDFFVASVEEGADLRPLVPDGRIYILAGMWPGNEELFFENDLVPIINSEEQLAVFMAAL
SERGDHPCVLHVDTGMNRLGLSPEEALALAHDPARPASFSPVLVMSHLACADDPGHPMNR
YQLQRFREVTAAFEGVPASLANSGGVFLGADYHFDLTRPGIAVYGGEAVNGAVNPMKAVV
TAEARIVQVRTVPSGGTASYGASVRFGRDSRIATVAIGYADGYHRSVSGGGVTLRQAMPS
GAFGFLHGMKVPHVGRVTMDLSLFDVTDLPEAAVRAGDYIEVFGRNVVIDDVARAGGTIG
YELLTSLGRRYHRTYVGGA
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagccccgagtttctttccgcctccagcaggctcaccgtcgacctcaccgcgctc
gccgacaattggcgggcgatgaacgagcggtccggaaaagcccgcgccgccgccgttctg
aaggccgatgcctacggtctcggcgtcgtgcatgccgctccggctctctatgccgccggc
gcgcgcgatttcttcgtggccagtgtcgaagaaggggccgatcttcgcccgcttgttccg
gatgggcgaatctacattctcgcgggaatgtggcccggcaacgaggagctcttcttcgag
aacgatctcgtgccgatcatcaactcggaagagcagctggcggtcttcatggcagcgctt
tccgaacggggcgaccacccctgcgttctccacgtcgacacgggcatgaaccggctcggc
ctgtcgcctgaggaggcgcttgccctcgcccacgaccctgcgcggcctgcgagtttctcg
ccggtcctcgtcatgagccatctggcctgcgccgacgatcccggacacccgatgaaccgc
tatcagcttcagcgtttccgcgaggtgaccgccgccttcgagggcgtgccggcgagcctt
gcaaattccggcggcgtgttcctcggtgcggactaccacttcgacctcacccggcccggc
atcgcggtctatggcggcgaggcggtaaatggcgcggtcaatccgatgaaagcggtcgtc
accgccgaagcgcgcatcgtgcaggtcaggacggttccatccggcggaacggcaagctac
ggcgcctcggtccgcttcggccgcgacagccgcattgcgacggtcgcgatcggctatgcc
gacggctaccaccgttcggtttcgggcggcggcgtcaccctcagacaggcgatgccctcg
ggcgccttcggtttcctgcatggtatgaaggtgccgcatgtcggtcgggtgacgatggat
ctgagcctgttcgatgtcacggacctgccggaagcggccgtacgtgccggcgattatatc
gaggtcttcgggcgcaatgtcgtcatcgacgacgtcgcgcgcgccggcggtaccatcggc
tacgagctgctgacgagcctcggccggcgctatcatcggacctatgtcggaggcgcttga

DBGET integrated database retrieval system