KEGG   Streptococcus mutans UA159: SMU_1834Help
Entry
SMU_1834          CDS       T00100                                 

Gene name
alr
Definition
(RefSeq) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
smu  Streptococcus mutans UA159
Pathway
smu00473  D-Alanine metabolism
smu01100  Metabolic pathways
smu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:smu00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    SMU_1834 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    SMU_1834 (alr)
Enzymes [BR:smu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     SMU_1834 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:smu01011]
 Precursor biosynthesis
  Racemase
   SMU_1834 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-GeneID: 1029043
NCBI-ProteinID: NP_722151
UniProt: Q8DSF4
LinkDB All DBs
Position
complement(1730483..1731598)
Genome map
AA seq 371 aa AA seqDB search
MIASYHRPTTALVHLDRIKFNIEQVQHHIPKSAKTFAVVKANAYGHGAVQVAQAIQKQVD
GFCVSNLDEALELRQAGLNDFILILGVLLPEEVALAKKENITITVADLDWFDKVQTENID
LAGLSVHVKVDSGMGRIGVRSTAEANQLIAGLQKAGATVNGIFTHFATADEASTVKFSQQ
LEMFTTLISQLDYKPQTVHASNSATSIWHSDTVMNAVRLGIVMYGLNPSGNALELPYEVK
PALELTSALVQVKEVQAGDTVGYGATYTASQAEIIGTVPVGYADGWTRDLQGFHVLVNGH
YCEIVGRVSMDQITIRLPKAYPLGTKVTLIGQDGHETISATDVAEKRETINYEVLCLISD
RVPRKYDKKFS
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgattgctagttaccatcgtccgacgacagctttagttcatttagatcgtatcaaattt
aatatcgaacaagttcaacaccatattccaaaatcagccaaaacttttgctgtggttaaa
gccaatgcctatggacatggtgctgttcaggtggctcaagccattcaaaagcaagttgac
ggtttttgtgtttctaatttagatgaggccttggaattgcgtcaggctggtctaaatgat
tttattttaattttgggtgtccttcttcctgaggaagttgccttggctaaaaaagaaaat
attactattacagttgctgacttagattggtttgataaagtacagacagaaaacattgat
ttagctggtctttcagtacatgtaaaagtcgattctggtatgggaagaattggagttcgc
agtactgcagaagcgaatcagcttattgcaggtttgcagaaggcgggagcgactgttaat
ggtatctttacccattttgcaacagcagatgaagcttctactgttaaattcagtcaacag
ttagagatgtttaccacccttatcagtcaattggattacaaacctcaaacagtacatgct
tctaactctgctacaagtatttggcatagtgatacagtaatgaatgctgttcgcctggga
atagtgatgtatggactcaatcctagtggcaatgcacttgaattaccttatgaagtaaag
ccagcattagagttgacatccgctcttgttcaggtcaaagaagtgcaagctggtgataca
gttggctatggtgcgacttatactgccagtcaggctgaaattattggaaccgtccctgtt
ggttacgctgatggttggacaagagatttgcaaggttttcatgttttggtgaatggtcac
tattgtgaaattgtggggcgtgtgtccatggatcaaatcactattcgcttacccaaagct
tatcctttagggaccaaagtcaccttaattgggcaggatggtcatgaaacgatttcagca
acagatgtcgctgaaaaacgagagacgattaattatgaagtgctctgtttgatcagtgac
cgagttcctcgaaaatatgataaaaagttcagttaa

DBGET integrated database retrieval system