KEGG   Streptococcus mutans UA159: SMU_599Help
Entry
SMU_599           CDS       T00100                                 

Definition
(RefSeq) D-alanyl-alanine synthetase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
smu  Streptococcus mutans UA159
Pathway
smu00473  D-Alanine metabolism
smu00550  Peptidoglycan biosynthesis
smu01100  Metabolic pathways
smu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:smu00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    SMU_599
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SMU_599
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    SMU_599
Enzymes [BR:smu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SMU_599
Peptidoglycan biosynthesis and degradation proteins [BR:smu01011]
 Precursor biosynthesis
  Amino acid ligase
   SMU_599
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST
Motif
Other DBs
NCBI-GeneID: 1029384
NCBI-ProteinID: NP_721032
UniProt: P95803
LinkDB All DBs
Structure
PDB: 

Jmol
Position
557804..558853
Genome map
AA seq 349 aa AA seqDB search
MSKETLVLLYGGRSAERDVSVLSAESVMRAINYDNFLVKTYFITQAGDFIKTQEFDSQPS
ETDKLMTNDTIIASQKIKPSDIYEEEAVVFPVLHGPMGEDGSIQGFLEVLKMPYVGTNIL
SSSVAMDKITTNQVLESATTIPQVAYVALIEGEPLESKLAEVEEKLIYPVFVKPANMGSS
VGISKAENRTDLKQAIALALKYDSRVLIEQGVDAREIEVGILGNTDVKTTLPGEIVKDVA
FYDYEAKYIDNKITMAIPAEIDPVIVEKMRDYAATAFRTLGCCGLSRCDFFLTEDGKVYL
NELNTMPGFTQWSMYPLLWENMGLSYSVLIEELVSLAKEMFDKRESHLV
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaacgcttgttttattatatggtggccgttctgcagaacgcgatgtttct
gtgctctcagctgagagtgtcatgcgagccataaattatgacaactttttagtcaaaact
tatttcattacgcaagcgggtgactttattaagacgcaagaatttgatagtcaaccatca
gaaactgataaactgatgacaaatgacacgattattgcttctcaaaaaattaagccaagt
gatatttatgaggaagaagcagttgtttttcctgttcttcatgggcctatgggagaggat
ggttctattcagggctttcttgaagttttaaaaatgccttatgtgggaaccaatattctg
tcatctagtgtagctatggataagattacaacaaaccaagttttagaaagtgcgactact
attcctcaagtagcttatgttgctcttattgaaggcgagcctttagaaagcaagttggca
gaagttgaagagaaattgatttatcctgtatttgttaagccagctaatatgggttctagt
gttggtatttctaaagcagaaaatcgcactgacttaaaacaagctattgcacttgctttg
aagtatgacagtcgtgttttaattgaacaaggtgtggatgcgcgtgagattgaggttggt
attttaggaaatactgatgttaaaacaactttaccgggagagattgtcaaagatgtggct
ttttatgattacgaagccaagtatattgataataagatcaccatggctattccggcagaa
atagatcctgttatcgttgaaaaaatgcgggattatgctgcaacagctttccgaactttg
ggctgctgtggactttctcgctgtgatttcttcctaacagaggatgggaaagtttatttg
aatgaactcaacactatgcccggctttactcagtggtctatgtatcctcttctttgggaa
aatatggggctgtcttattcagttttgattgaagaattagttagtcttgctaaagaaatg
tttgataaacgcgaaagccatttggtttaa

DBGET integrated database retrieval system