KEGG   Streptococcus mutans GS-5: SMUGS5_03135Help
Entry
SMUGS5_03135      CDS       T02185                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
smut  Streptococcus mutans GS-5
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:smut00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SMUGS5_03135
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SMUGS5_03135
  Energy metabolism
   00680 Methane metabolism
    SMUGS5_03135
Enzymes [BR:smut01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SMUGS5_03135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
658825..661548
Genome map
AA seq 907 aa AA seqDB search
MTINKLESRNDKEAIAEEITILTKLLDDATKTMVGSASFDKITLFKKLSIEEKHQELERE
IEQLTNEEMVVVSRYFSILPLLINISEDVNLAYEINYQNNNDIDYLGKLSATIELVSSQK
NAQEILENVNVVPVLTAHPTQVQRKTMLDLTNHIHELLRKYRDVKAGSINKQKWYDDMRR
YVELIMQTDIIREKKLKVTNEITNVMEYYNSSLIKGVTKLITEYKHLSQQKGFDLGNAKP
ITMGMWIGGDRDGNPFVTAETLKISALVQNEVILNYYIDKVSDLYRTFSLSTSLSTISNA
VKEMADRSTDVSIYREKEPYRKAFHYIQSRLQETLIYLKNNHLEELESEDSAQILPYQSA
QEFRNDLQLIKDSLLENNGSAFITGDLTELLQAVDVFGFFLASIDMRQDSSVHETCVAEL
LASANIVANYSDLPEEEKIAILLKELTEDPRILSATHVEKSEILQKELAIFKTARKLKDA
LGEDVIKQHIISHTESISDMFELAIMLKEVGLVDTDKARVQIVPLFETIEDLDNSREIMR
QYLNYDIVKKWIAANHNYQEIMLGYSDSNKDGGYLSSGWALYKAQNELTEIGSDNGVKIT
FFHGRGGTVGRGGGPSYEAITSQPFGSIKDRIRLTEQGEVIGNKYGNKDVAYYNLEMLVS
ATLDRMVTRRIVNSDNLVNYRLIMDEIVADSNLIYRDLVFGNKHFYDYFFAASPIREVSS
LNIGSRPAARKTITEISGLRAIPWVFSWSQNRIMFPGWYGVGSAFKHFIDKDEKNLAKLQ
EMYQSWPFFHSLLSNVDMVLSKSNMNIAFEYAKLCQDEETKEVFATILDEWQLTKNVILA
IESHKQLLEDNSYLKASLDYRLPYFNVLNYIQIELIKRQRRGELGENLENLIHITINGVA
TGLRNSG
NT seq 2724 nt NT seq  +upstreamnt  +downstreamnt
gtgacaatcaacaaactagaaagtagaaatgataaagaagcaattgctgaggagattact
attcttaccaaactactggacgatgctaccaaaacaatggttggcagtgctagctttgat
aagattactctctttaaaaaattatcaattgaagagaagcatcaagagttagaacgtgaa
attgagcagttaacaaatgaagaaatggtcgttgtttctcgttatttctccattttaccg
cttcttatcaatatttctgaagatgtcaatttagcttatgaaatcaactatcaaaacaat
aatgatattgattatttagggaaattatcagccactattgaacttgtttctagtcaaaaa
aatgctcaagaaattctggaaaatgttaatgttgtccctgttctaacagcgcatccaact
caagtgcagcgaaaaacgatgctggatttaactaatcatattcatgaacttttgcgtaag
taccgtgatgttaaagctggatctattaacaagcaaaaatggtatgacgatatgcgccgt
tatgttgagctcattatgcaaacagatattattcgtgaaaagaaattaaaagtcactaat
gaaattactaatgtcatggaatactataattcctctctgattaagggtgttactaaatta
attacagaatacaagcacttgtctcagcaaaaaggatttgatttaggaaatgctaaacca
attacgatgggaatgtggattggcggtgaccgtgatgggaatcctttcgtcactgctgaa
accctgaaaatatcagctctggtgcaaaatgaagtgattttaaattattatattgacaaa
gtttcagatctttatcgaacattttctctttcgaccagcctttctactattagcaatgca
gttaaagagatggcagatcgttcaacggatgtttcgatttaccgagaaaaagaaccctat
cgtaaggcttttcattatattcaatcaagattgcaagagactcttatttatttaaaaaac
aaccatttagaagagttggagtctgaagatagtgctcaaatccttccttatcaatcagcg
caagagtttagaaatgatttgcaactcatcaaagattctcttttagaaaataacggttct
gcttttattacgggtgatttaacagaattattgcaagcagttgatgtttttggtttcttt
ttagcttctattgatatgcgacaagattccagtgttcacgaaacctgtgtagcagaactg
ttagcttcagccaatattgttgctaactatagcgacttacctgaagaagaaaagattgct
attcttctcaaagaattgactgaagatcctcgaatactgtctgcaacgcatgttgaaaaa
tcggaaatattgcaaaaggaattagctatttttaaaacagctaggaaattgaaggatgct
ctgggagaagatgtgattaaacaacatatcatttcacacacagaaagcatttctgatatg
tttgaattagctatcatgctcaaagaagtcggcttggttgatacagataaggcgcgtgtg
caaattgttcctttatttgaaaccattgaggacttggataattctcgcgaaatcatgaga
cagtatctcaattatgatattgttaaaaaatggattgcagccaatcataattatcaggaa
attatgttgggttactcagattctaacaaggatggtggttatttatcgtctggctgggcg
ctctacaaagcacaaaatgaattgacagaaattggttctgataatggtgtcaaaatcacc
tttttccatggacgcggcggtactgttggacgtggtggcggtccatcttatgaggctatt
acatcacagccatttggttccatcaaggatcggattcgtttaacagaacaaggtgaggtt
attggtaataaatatggcaataaggatgttgcatactacaatctggaaatgctggtttca
gcaactcttgatcgcatggtgacaagaaggattgtcaattcagataacttagtcaattat
cgtttaatcatggatgaaattgttgctgacagtaatctcatttatcgtgatttagttttc
ggaaacaaacatttctatgattatttcttcgcagctagtccaattcgcgaagtttcaagt
ttgaatattggttcccgtccagcagctcgtaagacgattacagagatcagcggtttgcgc
gctattccttgggtattctcatggtctcaaaatcgcatcatgtttccaggatggtacggt
gtcggttcagcctttaaacattttatagataaggatgaaaagaatttggctaaattgcag
gaaatgtatcaatcatggcctttcttccattcattgttgtcaaatgttgacatggtttta
tccaaatcaaatatgaatattgcctttgaatatgctaaattatgtcaggatgaagaaaca
aaagaagtctttgcaactattttggatgaatggcaattaaccaaaaatgttattctagca
attgaaagtcacaaacagcttttagaagataatagttatttgaaagctagtcttgattat
cgtttaccttacttcaatgttttaaattatattcaaattgagttaattaaacgtcagcgc
cgtggtgaattaggtgagaatttagagaacctgattcacattactattaatggtgtcgca
actggtttacgaaattcaggttaa

DBGET integrated database retrieval system