KEGG   Serratia marcescens WW4: SMWW4_v1c27420Help
Entry
SMWW4_v1c27420    CDS       T02448                                 

Definition
(GenBank) hypothetical protein
  KO
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
smw  Serratia marcescens WW4
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:smw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMWW4_v1c27420
Enzymes [BR:smw01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     SMWW4_v1c27420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
2976492..2977367
Genome map
AA seq 291 aa AA seqDB search
MNEKIFTLPVSEQISPYISQRQLDELGVVVVSHPKVRAAVALQGAHLLAWQPSGEQPVIW
LSNNTPFATGKAIRGGVPICWPWFGPVAQPSHGFARNQPWSLTAHDEDENGVILTFTLKD
NEQTRKLWPHAFTLIARFKLGEECEIELESHGDYQATAALHSYFQVGEIDRVSVAGLGEP
YIDKVAGGAEAHQTGEVTFIGQTDRVYTRPEAFSQIRDPALARTIEVHHHHMSDVIAWNP
GVELSCSMGDMPNDGYKTMVCIETGRVSKPLVAAGEQPARLGVTFRSRKKA
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagaaaattttcaccctgcccgtttccgaacaaatttctccttatatcagccag
cggcaactcgatgagctgggcgtggttgtggtgtcgcacccgaaagtgcgcgcggccgtc
gcgctgcaaggcgcgcatttgctggcctggcagcccagcggtgagcagccggtgatttgg
ctcagcaacaacacgcctttcgccacaggcaaggccatccgcggtggcgtgccgatctgc
tggccgtggttcggcccggtggcgcaaccctcccacggctttgcccgcaaccagccctgg
agcctgacggcgcacgatgaagatgagaacggcgtcatcctgacctttacgctgaaagac
aatgagcagacccgcaaactgtggccgcacgccttcacgctgattgctcgcttcaagctg
ggtgaagagtgcgagatcgagctggaatcgcacggcgattatcaagccacggcggcgctg
cacagttacttccaggtcggcgaaatcgatcgggtcagcgtggcgggcctgggcgagcct
tatatcgacaaggtggcgggcggcgcagaggcgcatcagacgggtgaagtgacattcatc
ggccaaaccgaccgcgtctatacccgcccggaagctttcagccagatccgcgatccggca
ctcgctcgcaccatcgaggttcaccaccatcatatgagcgacgtcatcgcctggaacccc
ggcgtggaactctcctgcagcatgggggatatgccgaacgacggttacaagaccatggtc
tgcatcgagaccgggcgcgtcagcaaaccgctggtcgctgccggcgagcaacccgcccgt
ttgggtgtcaccttccgcagtcgtaagaaggcctga

DBGET integrated database retrieval system