KEGG   Stenotrophomonas maltophilia D457: SMD_2798Help
Entry
SMD_2798          CDS       T02061                                 

Gene name
gst4
Definition
(GenBank) Glutathione S-transferase
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
smz  Stenotrophomonas maltophilia D457
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:smz00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SMD_2798 (gst4)
Enzymes [BR:smz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     SMD_2798 (gst4)
Transporters [BR:smz02000]
 Other Transporters
  Pores ion channels [TC:1]
   SMD_2798 (gst4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(3114047..3114682)
Genome map
AA seq 211 aa AA seqDB search
MSTTLYGSTSTAALVVHWLLIELGIEHELVLLDFDAREHKSAEYLALNPAGVVPTLLIDG
LVLTEAAAIALYLADRHPDAGLLPALGTPQRADAYRWMFWCANTLQPAYRAWFYPHEVAG
EANVEASREMARQRLEAAWQHVATHLLAHGPYLLGATPCVVDYMLVMLMRWSRNMPRPSD
TWPSLKAHATSMKARPAFAEAYRREGITDWR
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccacgctgtatggttcgacaagcaccgccgcgctggtggtgcactggctgctg
atcgagctcggcatcgagcacgagttggtgctgctggatttcgacgcgcgcgagcacaag
tcggcggagtacctggcactgaatccggccggcgtggtgccgacgctgctgatcgatggc
ctggtactgactgaagcggcggcgatcgccctgtacctggccgaccgccatccggacgcc
ggtttgttgccggcactgggcacgccgcagcgcgccgatgcctaccgctggatgttctgg
tgtgccaatacgttgcagccggcctatcgcgcctggttctatccgcacgaggtggcgggc
gaggcaaacgtggaggccagtcgcgagatggcgcgacagcgcctggaagcggcctggcag
catgtggccacgcacctgctggcgcatgggccctacctgctgggcgccacgccctgcgtg
gtcgactacatgctggtgatgctgatgcgctggtcgcgcaacatgcccaggcccagtgac
acctggccgtcgctcaaggcacatgccacctcgatgaaggcgcgcccggcgttcgccgag
gcctaccgccgcgaaggcatcaccgactggcggtaa

DBGET integrated database retrieval system