KEGG   Streptococcus pneumoniae 670-6B: SP670_1773Help
Entry
SP670_1773        CDS       T01308                                 

Definition
(GenBank) sialidase B
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
snb  Streptococcus pneumoniae 670-6B
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:snb00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    SP670_1773
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SP670_1773
Enzymes [BR:snb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     SP670_1773
Bacterial toxins [BR:snb02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   SP670_1773
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
complement(1652381..1653751)
Genome map
AA seq 456 aa AA seqDB search
MKFGIPTLYTLSSGRVLSSIDARYGGTHDSKSKINIATSYSDDNGKTWSEPIFAMKFNDY
EEQLVYWPRDNKLKNSQISGSASFIDSSIVEDKKSGKTILLADVMPAGIGNNNANKADSG
FKEINGHYYLKLKKNGDNDFRYTVREKGVVYDETTNKPTNYTINDKYEVLEGGKSLTVEQ
YSVDFDSGSLRERHNGKQVPMNVFYKDSLFKVTPTNYIAMTTSQNRGESWEQFKLLPPFL
GEKHNGTYLCPGQGLALKSSNRLIFATYTSGELTYLISDDSGQTWKKSSASIPFENATAE
AQMVELRDGVIRTFFRTTTGKIAYMTSRDSGETWSKVSYIDGIQQTSYGTQVSAIKYSQL
IDGKEAVILSTPNSRSGRKGGQLVVGLVNKEDDSIDWRYHYDIDLPSYGYAYSAITELPN
HHIGVLFEKYDSWSRNELHLSNVVQYIDLEINDLTK
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
ttgaaatttgggataccgacactatatacattaagtagtggaagagttctatcaagtatt
gatgcacgttatggtgggactcatgattctaaaagtaagattaatattgccacttcttat
agtgatgataatgggaaaacgtggagtgagccaatttttgctatgaagtttaatgactat
gaggagcagttagtttactggccacgagataataaattaaagaatagtcaaattagtgga
agtgcttcattcatagattcatccattgttgaagataaaaaatctgggaaaacgatatta
ctagctgatgttatgcctgcgggtattggaaataataatgcaaataaagccgactcaggt
tttaaagaaataaatggtcattattatttaaaactaaagaagaatggagataacgatttc
cgttatacagttagagaaaagggtgtcgtttatgatgaaacaactaataaacctacaaat
tatactataaatgataagtatgaagttttggagggaggaaagtctttaacagtcgaacaa
tattcggttgattttgatagtggctctttaagagaaaggcataatggaaaacaggttcct
atgaatgttttctacaaagattcgttatttaaagtgactcctactaattatatagcaatg
acaactagtcagaatagaggagagagttgggaacaatttaagttgttgcctccgttctta
ggagaaaaacataatggaacttacttatgtcccggacaaggtttagcattaaaatcaagt
aacagattgatttttgcaacatatactagtggagaactaacctatctcatttctgatgat
agtggtcaaacatggaagaaatcctcagcttcaattccgtttgaaaatgcaacagcagaa
gcacaaatggttgaactgagagatggtgtgattagaacattctttagaaccactacaggt
aagatagcttatatgactagtagagattctggagaaacatggtcgaaagtttcgtatatt
gatggaattcaacaaacttcatatggcacacaagtatctgcaattaaatactctcaatta
attgatggaaaagaagcagtaattttgagtacaccaaattctagaagtggccgtaaggga
ggccaattagttgtcggtttggtcaataaagaagatgatagtattgattggagataccac
tatgatattgatttgccttcgtatggttatgcctattctgcgattacagaattgccaaat
catcacataggtgtactgtttgaaaaatatgattcgtggtcgagaaatgaattgcattta
agcaatgtagttcagtatatagatttggaaattaatgatttaacaaaataa

DBGET integrated database retrieval system