KEGG   Streptococcus pneumoniae TCH8431/19A: HMPREF0837_11418Help
Entry
HMPREF0837_11418  CDS       T01259                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxykinase (GTP)
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
snc  Streptococcus pneumoniae TCH8431/19A
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:snc00001]
   00620 Pyruvate metabolism
    HMPREF0837_11418 (ppc)
  Energy metabolism
   00680 Methane metabolism
    HMPREF0837_11418 (ppc)
Enzymes [BR:snc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     HMPREF0837_11418 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1311849..1314545)
Genome map
AA seq 898 aa AA seqDB search
MSLQKLENYSNKSVVQEEVLILTELLEDITKNMLAPETFEKIIQLKELSTQEDYQGLNRL
VTSLSNDEMVYISRYFSILPLLINISEDVDLAYEINHQNNIDQDYLGKLSTTIKLVAEKE
NAVEILEHLNVVPVLTAHPTQVQRKSMLDLTNHIHSLLRKYRDVKLGLINKDKWYNDLRR
YIEIIMQTDMIREKKLKVTNEITNAMEYYNSSFLKAVPHLTTEYKRLAQAHGLNLKQAKP
ITMGMWIGGDRDGNPFVTAKTLKQSALTQCEVIMNYYDKKIYQLYREFSLSTSIVNVSKQ
VREMARQSKDNSIYREKELYRRALFDIQSKIQATKTYLIEDEEVGTRYETANDFYKDLIA
IRDSLLENKGESLISGDFVELLQAVEIFGFYLASIDMRQDSSVYEACVAELLKSAGIHSR
YSELSEEEKCDLLLKELEEDPRILSATHAEKSELLAKELAIFKTARVLKDKLGDDVIRQT
IISHATSLSDMLELAILLKEVGLVDTERARVQIVPLFETIEDLDHSEETMRKYLSLSLAK
KWIDSRNNYQEIMLGYSDSNKDGGYLSSCWTLYKAQQQLTAIGDEFGVKVTFFHGRGGTV
GRGGGPTYEAITSQPLKSIKDRIRLTEQGEVIGNKYGNKDAAYYNLEMLVSAAINRMITH
KKSDTNTPNRYEAIMDQVVDRSYDVYRDLVFGNEHFYDYFFESSPIKAISSFNIGSRPAA
RKTITEIGGLRAIPWVFSWSQSRVMFPGWYGVGSSFKEFINKNPENIAILRDMYQNWPFF
QSLLSNVDMVLSKSNMNIAFEYAKLCEDEQVKAIYETILNEWQVTKNVILAIEGHDELLA
DNPYLKASLDYRMPYFNILNYIQLELIKRQRRGELSSDQERLIHITINGIATGLRNSG
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
atgtctcttcaaaaattagaaaattatagtaataaaagtgttgtgcaagaagaagtcttg
attctaacagaattactggaagatattactaaaaatatgcttgccccagagacctttgaa
aaaataatacagttgaaagaattatcaacgcaggaagattatcaaggtctaaaccgtcta
gtgactagcttatcaaatgatgaaatggtctatatttcacgctatttctctatcttacct
cttttgattaatatttcagaggatgtggatttagcttatgaaatcaatcatcaaaataat
attgatcaggactatttaggtaaattatctacaacgattaaattggtagcagaaaaggaa
aatgccgttgagatcctagaacacttgaatgttgtccctgttttgacagcccatccaaca
caagtgcaacgcaaaagtatgttggatttaacaaatcatattcatagtcttttgcgtaaa
taccgtgatgttaagttggggttgatcaataaagataaatggtacaatgatttgcgtcgt
tacatcgaaattatcatgcagacagacatgattcgtgagaaaaaattaaaagtgactaac
gaaatcacgaatgctatggaatattataacagctcctttttgaaagctgtacctcatttg
acgacggagtataagcgcttagcgcaagcgcatggtctgaatttaaaacaggctaaacca
atcaccatgggtatgtggataggtggtgaccgtgatggaaatccatttgttacagcaaag
accttgaagcagtctgcactcactcagtgtgaagtcatcatgaactactatgataaaaag
atttaccaactttatcgtgaattttctctttcaactagcattgtcaacgtcagcaagcaa
gtcagagaaatggctcgtcaatccaaggataactcgatttaccgcgaaaaagagctttac
cgtcgtgccttgtttgatattcaatcaaaaattcaggcaactaaaacctatctgattgag
gatgaagaagttgggactcgttatgaaaccgccaatgatttctacaaggatttgattgcc
attcgagattctctactagaaaataagggcgagtccttgatttcaggtgattttgtggaa
ttattgcaggcagtagagatatttggtttttacttagcatcaattgatatgcgacaagac
tctagcgtctatgaagcctgtgtggcagaactcttgaaatcagcaggaattcattctcgt
tatagcgagttgagcgaagaagaaaagtgtgaccttctcttgaaagaattagaagaagat
ccccgaattctttctgcgactcacgcagaaaaatcagaattattagcaaaagaattagct
atttttaagacggctcgtgttttgaaagataagttgggagatgatgtcatccgtcagacc
atcatttcacatgcaaccagcctttctgatatgctagaattagctattctgttaaaagaa
gtaggactggtggatacggaaagggcgcgtgttcagattgttcccctttttgaaacaatt
gaagacttggatcattcagaggaaacaatgagaaaatatctttctcttagccttgccaaa
aaatggattgactcacgaaataactaccaagaaatcatgcttggctactctgacagtaat
aaagatggcggttacttgtcatcatgttggaccctctacaaggctcaacaacaattgact
gctattggagatgaatttggcgttaaggttaccttcttccatggtcgtggtggtactgtc
ggtcgtggtggtgggccaacctatgaagccattacatctcaaccgctcaagtctatcaag
gatcgtatccgtttgacggagcagggtgaagtaattgggaataaatacggtaacaaagac
gccgcttactataaccttgaaatgctagtatctgcagctattaaccgtatgattactcat
aagaagagtgataccaataccccaaatcgttatgaagccattatggatcaagtagtggac
cgtagttacgatgtctaccgtgatttggtctttggtaatgagcatttctatgattatttc
ttcgagtcaagtccaatcaaggctatttcaagttttaatattggttctcgtccagccgct
cgtaagactattactgaaatcggtggtttgcgtgccatcccttgggtattctcatggtca
cagagtcgtgttatgttccctggatggtacggggttggttcaagcttcaaggaatttatc
aataaaaatccagagaatattgctatcttacgagatatgtaccaaaattggcctttcttc
caatcgcttctttcaaatgttgatatggttttgtcaaaatcaaatatgaatattgctttt
gaatatgctaaactttgtgaagacgagcaagttaaggccatctatgagactattttaaat
gaatggcaagttactaagaacgttatcttggctattgaaggacatgacgaactcttagct
gacaatccatatctaaaagctagtctggattaccgtatgccttactttaatattctcaac
tatattcagttagagttgattaaacgccaacgtcgtggagaattgtccagtgatcaagaa
cgattgattcatatcaccatcaacggaattgcgacaggattgcgtaattcaggttga

DBGET integrated database retrieval system