KEGG   Streptococcus pneumoniae ATCC 700669 (serotype 23F ST81 lineage): SPN23F16720Help
Entry
SPN23F16720       CDS       T00843                                 

Gene name
ddlA
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sne  Streptococcus pneumoniae ATCC 700669 (serotype 23F ST81 lineage)
Pathway
sne00473  D-Alanine metabolism
sne00550  Peptidoglycan biosynthesis
sne01100  Metabolic pathways
sne01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sne00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    SPN23F16720 (ddlA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SPN23F16720 (ddlA)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    SPN23F16720 (ddlA)
Enzymes [BR:sne01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SPN23F16720 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:sne01011]
 Precursor biosynthesis
  Amino acid ligase
   SPN23F16720 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 PAXNEB
Motif
Other DBs
NCBI-ProteinID: CAR69444
UniProt: B8ZM66
LinkDB All DBs
Position
complement(1610603..1611646)
Genome map
AA seq 347 aa AA seqDB search
MKQTIILLYGGRSAEREVSVLSAESVMRAVNYDRFTVKTFFISQSGDSIKTQEFSHAPGQ
EDRLMTNETIDWDKKVAPSAIYEEGAVVFPVLHGPMGEDGSVQGFLEVLKMPYVGCNILS
SSLAMDKITTKRVLESAGIAQVPYVAIVEGDDVTAKIAEVEEKLAYPVFTKPSNMGSSVG
ISKSENQEELRQALKLAFRYDSRVLVEQGVNAREIEVGLLGNYDVKSTLPGEVVKDVAFY
DYDAKYIDNKVTMDIPAKISDDVVAVMRQNAETAFRAIGGLGLSRCDFFYTDKGEIFLNE
LNTMPGFTQWSMYPLLWENMGISYPELIERLVDLAKESFDKREAHLI
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaacgattattcttttatatggtggacggagtgcggaacgcgaagtctctgtc
ctttcagctgagagtgtcatgcgtgcggtcaattacgaccgtttcacagtcaagactttc
tttatcagtcagtcaggtgactctatcaaaacgcaggaatttagtcatgctccggggcaa
gaagaccgtctcatgaccaatgaaaccattgattgggataagaaagttgcaccaagtgct
atctacgaagaaggtgcagtggtctttccagtccttcacgggccaatgggagaagatggc
tctgttcaaggattcttggaagttttgaaaatgccttacgttggttgcaacattttgtca
tcaagtcttgccatggataaaatcacgactaagcgtgttctggaatctgctggtattgcc
caagttccttatgtggctatcgttgaaggcgatgatgtgactgctaaaatagctgaagtg
gaagaaaaattggcttatccagtcttcactaagccgtcaaacatggggtctagtgtcggt
atttctaagtctgaaaaccaagaagaactccgtcaagccttaaaacttgccttccgatat
gacagccgtgtcttggttgagcaaggagtgaatgcccgtgaaattgaggttggcctcttg
ggtaactacgatgtcaagagcacgctacctggagaagttgtcaaggacgttgccttttat
gactacgatgccaagtatattgataacaaggttactatggatattcctgccaaaatcagt
gatgatgtggtggctgtcatgcgtcaaaatgcagaaacagccttccgtgccattggtggc
cttggtctatctcgttgcgatttcttctatacagataagggagagatttttctcaacgag
ctcaataccatgccaggtttcacccagtggtctatgtacccactactttgggaaaatatg
gggatcagctacccagaactaatcgagcgtttggttgaccttgccaaggaaagttttgac
aagcgcgaagcgcatttgatataa

DBGET integrated database retrieval system