KEGG   Pseudomonas geniculata: A7E77_09070Help
Entry
A7E77_09070       CDS       T04479                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
snj  Pseudomonas geniculata
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:snj00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    A7E77_09070
Enzymes [BR:snj01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     A7E77_09070
Transporters [BR:snj02000]
 Other Transporters
  Pores ion channels [TC:1]
   A7E77_09070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(1886589..1887206)
Genome map
AA seq 205 aa AA seqDB search
MPADLTLYTNPMSRGRIARWMLEETGAPYDVVLLDYATTMKAEPYLSINPMAKVPAIVHR
GHVVTEGAAICAYCADAFPDAGLAPTDDERADYYRWLFFAAGPAEQAITNRSMGVAPTAE
QQRMAGYGNYDRMVDVLERAVAAHPYIAGDRFTAADVYVGAQVIWGLQFGSLPKRTAFEE
YAGRLASREALIRAAALDDAAVAAG
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccgatctgacgctctacaccaacccgatgtcgcgcggccggatcgcgcgctgg
atgctcgaggaaaccggcgcgccttatgacgtcgtgctgctcgattatgcgacgacgatg
aaggccgaaccgtatctgtcgatcaacccgatggccaaggtgcccgcgatcgttcatcgc
ggccatgtggtgaccgaaggcgcggcgatctgcgcctattgcgccgacgcctttccggac
gccgggctggcaccgaccgacgacgagcgcgcggattactaccgctggctgttcttcgcc
gcggggccggcggagcaggcgatcaccaaccgatcgatgggcgtcgcgccgaccgcggag
cagcagcggatggcgggatacggcaattacgatcgcatggtcgacgtgctggagcgcgcg
gtcgcggcacatccgtacatcgccggcgatcggttcaccgcggcggacgtctatgtcggg
gcgcaggtgatatgggggctgcaattcgggtcgctgcccaagcgcacggcgttcgaggaa
tatgcgggccggttggcaagccgcgaggcgctgatccgcgcggcggcgctggacgatgcg
gcggtcgccgcggggtag

DBGET integrated database retrieval system