KEGG   Streptococcus pneumoniae 70585: SP70585_1731Help
Entry
SP70585_1731      CDS       T00872                                 

Definition
(GenBank) neuraminidase
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
snm  Streptococcus pneumoniae 70585
Pathway
snm00511  Other glycan degradation
snm00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:snm00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    SP70585_1731
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SP70585_1731
Enzymes [BR:snm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     SP70585_1731
Bacterial toxins [BR:snm02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   SP70585_1731
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sialidase BNR_2 Laminin_G_3 BNR_3 BNR Sortilin-Vps10 Gram_pos_anchor
Motif
Other DBs
NCBI-ProteinID: ACO17645
UniProt: C1C8T0
LinkDB All DBs
Structure
PDB: 

Jmol
Position
complement(1604204..1607047)
Genome map
AA seq 947 aa AA seqDB search
MIVGAVVFGTSPVLAQEGASEQPLANETQLSGESSTLTDTEKSQPSSETELSGNKQEQER
KDKQEEKIPRDYYARDLENVETVIEKEDVETNASNGQRVDLSSELDKLKKLENATVHMEF
KPDASAPRFYNLFSVSSDTKENEYFTMSVLDNTALIEGRGANGEQFYDKYTDAPLKVRPG
QWNSVTFTVEQPTAELPHGRVRLYVNGVLSRTSLKSGNFIKDMPDVNQAQLGATKRGNKT
VWGSNLQVRNLTVYDRALSPEEVQTRSQLFERGDLEKKLPEGAKISEKEDVFEGGMNNKP
NKDGIKSYRIPALLKTDKGTLIAGADERRLHSSDWGDIGMVIRRSEDNGKTWGDRVTITN
LRDNPKASDPSIGSPVNIDMVLVQDPETKRIFSIYDMFPEGKGIFGMSSQKEEAYKKIDG
KTYQILYREGEKGAYTIRENGTVYTPDGKATDYRVVVDPVKPAYSDKGDLYKGDQLLGNI
YFTTNKTSPFRIAKDSYLWMSYSDDDGKTWSAPQDITPMVKADWMKFLGVGPGTGIVLRN
GPHKGRILIPVYTTNNVSHLNGSQSSRVIYSDDHGKTWHAGEAVNDNRQVDGQKIHSSTM
NNRRAQNTESTVVQLNNGDVKLFMRGLTGDLQVATSKDGGVTWEKDIKRYPQVKDVYVQM
SAIHTMHNGKEYIILSNAGGPKRENGMVHLARVEENGELTWLKHNPIQKGEFAYNSLQEL
GNGEYGILYEHTEKGQNAYTLSFRKFNWEFLSKNLISPTEAKVKRTREMGKGEMGKGVIG
LEFDSEVLVNKAPTLQLANGKTATFLTQYDSKTLLFAVDKEDIGQEIIGIAKGSIESMHN
LPVNLAGARVPGGVNGSKAAVHEVPEFTGGVNGTEPAVHEIAEYKGSDSLVTLTTKEDYT
YKAPLAQQALPETGNKESDLLASLGLTAFFLGLFTLGKKERTIREEF
NT seq 2844 nt NT seq  +upstreamnt  +downstreamnt
atgattgtaggagcagtggtatttggaacgtctcctgttttagctcaagaaggggcaagt
gagcaacctctggcaaatgaaactcaactttcgggggagagctcaaccctaactgataca
gaaaagagccagccttcttcagagactgaactttctggcaataagcaagaacaagaaagg
aaagataagcaagaagaaaaaattccaagagattactatgcacgagatttggaaaatgtc
gaaacagtgatagaaaaagaagatgttgaaaccaatgcttcaaatggtcagagagttgat
ttatcaagtgaactagataaactaaagaaacttgaaaacgcaacagttcacatggagttt
aagccagatgcatcagctccacgcttttacaatctcttctctgtatccagtgacaccaag
gaaaatgagtactttactatgtcggtccttgataatacagctcttattgaagggcgtggc
gctaacggagagcagttctatgataagtatacagatgctcctttgaaagttcgcccagga
caatggaattccgtgacctttactgtcgaacaaccgacagcggagttacctcatggacga
gttcgtctctatgtgaacggtgtcttatctcgaacaagtctcaaatctggtaactttatc
aaagatatgccagatgttaatcaagctcaacttggagcaaccaaacggggcaataagaca
gtttggggaagcaatctacaagttcgaaacctaaccgtctatgatcgtgccttaagccca
gaagaagttcagacgagaagccaactatttgaaagaggtgatttggagaagaaacttcca
gaaggtgcgaaaatctcagagaaagaagacgtctttgaagggggaatgaacaacaaacca
aataaagatggaattaagagttatcgtattccagctcttctcaagacagataaaggaact
ctgattgcaggtgcagatgaacgccgtcttcattctagtgactggggtgatatcggtatg
gtcatcagacgtagtgaagataatggtaaaacttggggtgaccgagtaaccattaccaac
ttacgtgacaatccaaaagcttctgacccatcgatcggttcaccagtgaatatcgatatg
gtgttggttcaagatcctgaaaccaaacgaatcttttctatctatgacatgttcccagaa
gggaagggaatctttggaatgtcttcacaaaaagaagaagcctacaaaaaaatcgatgga
aaaacctatcaaatcctctatcgtgaaggagaaaagggagcttataccattcgagaaaat
ggtactgtctatacaccagatggtaaggcgacagactatcgcgttgttgtagatcctgtt
aaaccagcctatagcgacaagggtgatctatacaagggtgaccaattactaggcaatatc
tacttcacaacaaacaaaacttctccatttagaattgccaaggatagctatctatggatg
tcctacagtgatgacgacgggaagacatggtcagcgcctcaagatattactccgatggtc
aaagccgattggatgaaattcttgggtgtaggtcctggaacaggaattgtacttcggaat
gggcctcacaagggacggattttgataccggtttatacgactaataatgtatctcactta
aatggctcgcaatcttctcgtgtcatctattcagatgatcatggaaaaacttggcatgct
ggagaagcggtcaacgataaccgtcaggtagacggtcaaaagatccactcttctacgatg
aacaatagacgtgcgcaaaatacagaatcaacggtggtacaactaaacaatggagatgtt
aaactctttatgcgtggtttgactggagatcttcaggttgctacaagtaaagacggagga
gtgacttgggagaaggatatcaaacgttatccacaggttaaagatgtctatgttcaaatg
tctgctatccatacgatgcataatggaaaagaatacatcatcctcagcaatgcaggtgga
ccgaaacgtgaaaatgggatggtccacttggctcgtgtcgaagaaaatggtgagttgact
tggctcaaacacaatccaattcaaaaaggagagtttgcctataattcgctccaagaatta
ggaaatggggagtatggcatcttgtatgaacatactgaaaaaggacaaaatgcctatacc
ctatcatttagaaaatttaattgggaatttttgagcaaaaatctgatttctcctaccgaa
gcgaaagtgaagcgaactagagagatgggcaaaggagagatgggcaaaggagttattggc
ttggagttcgactcagaagtattggtcaacaaggctccaacccttcaattggcaaatggt
aaaacagcgactttcctaacccagtatgatagcaagaccttgttgtttgcagtagataag
gaagatatcggacaggaaattattggtatagctaaaggaagcatcgaaagtatgcataat
cttcctgtaaatctagcaggtgccagagttcctggcggagtaaatggtagcaaagcagcg
gtgcatgaagttccagaatttacagggggagttaatggtacagagccagctgttcatgaa
atcgcagagtataagggatctgattcgcttgtaactcttactacaaaagaagattatact
tacaaagctcctcttgctcagcaggcacttcctgaaacaggaaacaaggagagtgacctc
ctagcttcactaggactaacagctttcttccttggtctgtttacgctagggaaaaaagag
agaacaataagagaagaattctaa

DBGET integrated database retrieval system