KEGG   Starkeya novella: Snov_2431Help
Entry
Snov_2431         CDS       T01258                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sno  Starkeya novella
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sno00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Snov_2431
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Snov_2431
   00680 Methane metabolism
    Snov_2431
Enzymes [BR:sno01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Snov_2431
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(2550142..2552928)
Genome map
AA seq 928 aa AA seqDB search
MSVALTIALPDAELDADGELDLSLRDDIRMLGRVLGDTLRDQEGEPTFELVERIRRVSTR
FHREEDEGARHELEAILNQLDPEQTVTIVRAFSYFSHLANIAEDQNVIRRMRAAAAAGNG
GPPSVARAIEKARAHGVSSAELRGFFDTALASPVLTAHPTEVRRRSTLTHEMCIAELLAD
RARLDPTPEEQELADDELRRRVLMLWQTNLLRRTKLTVLDEVANGLAYYDYTFLRQLPKL
YAAVEDRLAALDGSGEASELASFLRIGSWIGGDRDGNPFVTADVTRETLRMQSAQAVRFY
LEELDALGGELSISTIRVKVSGELMGLVDASSDGSPHRRNEPYRLATGVITTRLRATAFR
LEIADLLGITEKPAAAPYASAQELRADLDIIDRSLRTHGSSAIARGKLRALRRAVDCFGF
HLAVLDSRQNSDVHERCVAELFEVAAPGTDYKGLPEGTRVALLLRELATARPLTSPFVAY
SDETVGEMAMLRTCARIHQIYGPEAIQTCIISKAEGVSDMLELALLLKEVGLVDPAGTAA
VNIVPLFETIEDLRNAARVMEQMFRLPEYRKLVDSRGGVQEVMLGYSDSNKDGGFVTSGW
ELYKAEIELIEVFKRHGVRLRLFHGRGGSVGRGGGPSYDAILAQPGGAVQGQIRITEQGE
IISSKYSNPAVGRGNLEILAAATMEATLLSGDAKAPREEYLSVMEKISDAAFKAYRALVY
ETPRFEDYFWESTVINEIATLNIGSRPASRKKTRRVEDLRAIPWVFSWAQCRLMLPGWYG
FGTAVGEWLKANPDGLPLLQEMYREWPFFRTQLSNMDMVLSKSSIAIASRYAELVEDVEL
RESIFGRIRAEHQAAIDALLSIAQQPKLLGSNPLLDRSIRARFPYIDPLNHVQVGLLRAY
RGNDTDEKVLQGIQLTINGISAGLRNSG
NT seq 2787 nt NT seq  +upstreamnt  +downstreamnt
atgtccgttgccctcaccatcgccctgcccgatgccgagctcgatgccgacggcgaactc
gacctgtcgctgcgcgacgacatccgcatgctgggccgggtgctgggcgacacgctgcgc
gaccaggagggcgagccgaccttcgaactggtggagcgcatccgccgcgtctccacccgc
ttccaccgcgaggaggacgagggcgcccggcacgagctggaggcgatcctgaaccagctc
gaccccgagcagaccgtcaccatcgtccgggctttctcctatttctcccacctcgccaac
atcgccgaggaccagaacgtcatccgccgcatgcgcgcggcggcggcggccggcaatggc
ggtccgcccagcgtggcccgggcgatcgagaaggcacgcgcgcatggcgtctcgtccgcc
gagctgcgcggcttctttgataccgcgctggcgagcccggtgctcaccgcccacccgacc
gaggtgcgccgccgctcgacgctgacgcatgagatgtgcatcgccgagctgctggccgac
cgcgcccggctcgacccgacgccggaggagcaggagctcgccgacgacgagctgcgccgc
cgcgtgctgatgctgtggcagaccaacctgctgcgccggaccaagctgacggtgctggac
gaggtggcgaacgggctcgcctattacgactacaccttcctgcgccagctgccgaagctc
tatgcggcggtggaggaccggctcgccgcgctcgacggcagcggcgaggcttccgaactc
gcctccttcctgcgcatcggcagctggatcggcggcgaccgcgacggcaaccccttcgtc
accgccgacgtcacccgcgagacgctgcgcatgcagagcgcgcaggcggtgcgcttctat
ctggaggagctcgacgcgctcggcggcgaactctcgatcagcaccatccgggtgaaggtc
tccggcgagctgatggggctggtcgacgcctcctcggacggctcgccgcaccggcgcaac
gagccctaccgcctcgccaccggcgtcatcactacgaggctgcgcgccaccgccttccgg
ctggagatcgccgacctgctcggcatcaccgagaagccggcggcggcgccctatgcctcc
gcccaggaattgcgagccgacctcgacatcatcgaccgctcgctgcgcacgcacggctcc
agcgccatcgcgcggggcaagctgcgggcgctgcgtcgggcggtcgattgcttcggcttc
catctcgcggtgctggattcccgccagaactcggacgtccacgagcgctgcgtcgccgag
ctgttcgaggtcgccgcccccggcaccgactacaagggcctgccggagggcacgcgcgtc
gccctgctgctgcgcgaactcgccaccgcgcgcccgctcacctcgcccttcgtcgcctat
tccgacgagacggtgggggagatggcgatgctgcgcacctgcgcccgcatccaccagatc
tacggccccgaggcgatccagacctgcatcatctccaaggccgagggcgtctcggacatg
ctggagctggcgctgctgctcaaggaggtcggcctcgtcgatcccgccggtacggcggcg
gtgaacatcgtgccgctgttcgagaccatcgaggacctgcgcaacgccgccagggtgatg
gagcagatgttccgcctgccggaataccgcaagctggtcgacagccgcggcggcgtgcag
gaggtgatgctcggctattccgacagcaacaaggatggcggcttcgtcacctccggctgg
gagctctacaaggccgagatcgagctgatcgaggtgttcaagcgccacggcgtgcggctg
cggctgttccacggccgcggcggctcggtcggccgcggcggcgggccgagctacgatgcc
atcctcgcccagccgggcggggcggtgcaggggcagatccgcatcaccgagcagggcgag
atcatctcgtccaagtactccaacccggcggtcgggcgcggcaacctcgaaatcctcgcc
gccgcgaccatggaggcgacgctgctctccggcgacgccaaggcgccgcgcgaggaatat
ctgtcggtgatggagaagatctccgacgcggcgttcaaggcctatcgggcgctggtctac
gagaccccgcgcttcgaggattatttctgggaatccaccgtcatcaacgagatcgcgacg
ctgaacatcggctcgcgcccggcctcgcgcaagaagacgcggcgggtggaggacctgcgc
gcgatcccgtgggtgttctcctgggcgcagtgccggctgatgctgccgggctggtacggc
ttcggtacggcggtgggcgaatggctgaaggccaatcccgacggcctgccgctcttgcag
gagatgtaccgcgagtggccgttcttccgcacacagctctccaacatggacatggtgctg
tcgaagagctccatcgccatcgcctcgcgctatgccgagctggtggaggacgtggagctg
cgcgagagcatcttcgggcgcatccgcgccgagcatcaggcggcgatcgacgcgctgctg
tcgattgcgcagcagccgaagctgctgggttcgaacccgctgctcgaccgctccatccgc
gcgcgcttcccctatatcgacccgctgaaccatgtgcaggtcggcctgctgcgcgcctat
cgcggcaacgacaccgacgagaaggtgctgcaggggatacagctgacgatcaacggcatc
tcggcaggactgcgcaactcggggtaa

DBGET integrated database retrieval system