KEGG   Starkeya novella: Snov_3140Help
Entry
Snov_3140         CDS       T01258                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sno  Starkeya novella
Pathway
sno00473  D-Alanine metabolism
sno00550  Peptidoglycan biosynthesis
sno01100  Metabolic pathways
sno01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sno00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Snov_3140
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Snov_3140
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Snov_3140
Enzymes [BR:sno01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Snov_3140
Peptidoglycan biosynthesis and degradation proteins [BR:sno01011]
 Precursor biosynthesis
  Amino acid ligase
   Snov_3140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 CPSase_L_D2 RimK
Motif
Other DBs
NCBI-ProteinID: ADH90415
JGI: Snov_3140
UniProt: D7A7V7
LinkDB All DBs
Position
complement(3282469..3283389)
Genome map
AA seq 306 aa AA seqDB search
MSKHVAVLMGGWSSERQVSLWSGEACAKAAESVGYRVTRVDVGRDIAQVLTELKPDVALN
ALHGPYGEDGTIQGVLEFLQVPYTHSGVLASALAMDKAQAKIILAASDVPVPEGRVVTRA
EAARGHVLPRPYVLKPVSEGSSVGVFIIKEDQEHPPQELHRPDWPHGDLLLAERYIPGLE
LTCAVMGDEALGVIEIQSDLRFYDYEAKYTPGGSVHILPARILPNVYQKVRMLAVKAHRA
LGCRGISRSDFRYDDRTGDESGLVCLEVNTQPGMTELSLVPELAAHAGHSFGELVRWMVE
DASLDR
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagcatgtcgccgtcctcatgggcggctggtcgtcggagcggcaggtgtcgcta
tggtcgggcgaggcctgcgccaaggccgccgagagcgtcggctaccgcgtgacgcgcgtg
gatgtcgggcgcgacatcgcccaggtgctcaccgagctgaagcccgacgtggcgctgaac
gctctgcacgggccctatggcgaggacggcaccatccagggcgtgctggagttcctgcag
gtcccctacacgcattccggcgtgctcgcctcggcgctcgccatggacaaggcgcaggcc
aagatcatcctcgccgccagcgacgttcccgtgccggagggccgggtggtgacgcgggcc
gaggcggcgcgcggacatgtgctgccacgtccttacgtgctcaagccggtctcggaaggc
tcctcggtcggcgtgttcatcatcaaggaggaccaggagcatccgccgcaggagctgcac
cggcccgattggccgcacggtgatttgcttttggccgagcgttacatccccggactggag
cttacctgcgccgtgatgggcgacgaggcgctcggcgtcatcgaaatccagtccgaccta
aggttctatgattacgaggcaaaatacactcccggcggttccgttcacattctcccggcc
cgaattttaccgaatgtttaccaaaaggtgcggatgttagcggttaaggcgcatcgcgcg
ctcggctgtcggggcatcagtaggtcggacttccgatacgacgatcggaccggggacgaa
tccggtctggtttgtctggaagttaacacccagcccggaatgaccgagttgtcgcttgtg
cccgaactggcagcccatgcgggccattcgttcggtgagcttgtacgatggatggtggag
gacgcttcgctcgaccgctga

DBGET integrated database retrieval system