KEGG   Streptococcus pneumoniae AP200: SPAP_1692Help
Entry
SPAP_1692         CDS       T01309                                 

Definition
(GenBank) neuraminidase NanB
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
snp  Streptococcus pneumoniae AP200
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:snp00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    SPAP_1692
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SPAP_1692
Enzymes [BR:snp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     SPAP_1692
Bacterial toxins [BR:snp02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   SPAP_1692
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
complement(1595527..1597146)
Genome map
AA seq 539 aa AA seqDB search
MYVNGIEVFSETVDTFLPISNINGIDKATLGAVNREGKEHYLAKGSIDEISLFNKAISDQ
EVSNIPLSNPFQLIFQSGDSTQANYFRIPTLYTLSSGRVLSSIDARYGGTHDSKSKINIA
TSYSDDNGKTWSEPIFAMKFNDYEEQLVYWPRDNKLKNSQISGSASFIDSSIVEDKKSGK
TILLADVMPAGIGNNNANKADSGFKEINGHYYLKLKKNGDNDFRYTVRENGVVYDETTNK
PTNYTINDKYEVLEGGKSLTVEQYSVDFDSSSLRERHNGKQVPMNVFYKDSLFKVTPTNY
IAMTTSQNRGESWEQFKLLPPFLGEKHNGTYLCPGQGLALKSSNRLIFATYTSGELTYLI
SDDSGQTWKKSSASIPFKNATAEAQMVELRDGVIRTFFRTTTGKIAYMTSRDSGETWSEV
SYIDGIQQTSYGTQVSAIKYSQLIDGKEAVILSTPNSRSGRKGGQLVVGLVNKEDDSIDW
KYHYDIDLPSYGYAYSAITELPNHHIGVLFEKYDSWSRNELHLSNVVQYIDLEINDLTK
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgtatgttaatggaatagaagtgttctctgaaacagttgatacatttttgccaatttca
aatataaatggtatagataaggcaacactaggagctgttaatcgtgaaggtaaggaacat
tacctcgcaaaaggaagtattgatgaaatcagtctatttaacaaagcaattagtgatcag
gaagtttcaaatattcccttgtcaaatccatttcagttaattttccaatcaggagattct
actcaagctaactattttagaataccgacactatatacattaagtagtggaagagttcta
tcaagtattgatgcacgttatggtgggactcatgattctaaaagtaagattaatattgcc
acttcttatagtgatgataatgggaaaacgtggagtgagccaatttttgctatgaagttt
aatgactatgaggagcagttagtttactggccacgagataataaattaaagaatagtcaa
attagtggaagtgcttcattcatagattcatccattgttgaagataaaaaatctgggaaa
acgatattactagctgatgttatgcctgcgggtattggaaataataatgcaaataaagcc
gactcaggttttaaagaaataaatggtcattattatttaaaactaaagaagaatggagat
aacgatttccgttatacagttagagaaaatggtgtcgtttatgatgaaacaactaataaa
cctacaaattatactataaatgataagtatgaagttttggagggaggaaagtctttaaca
gtcgaacaatattcggttgattttgatagtagctctttaagagaaaggcataatggaaaa
caggttcctatgaatgttttctacaaagattcgttatttaaagtgactcctactaattat
atagcaatgacaactagtcagaatagaggagagagttgggaacaatttaagttgttgcct
ccgttcttaggagaaaaacataatggaacttacttgtgtcctggacaaggtttagcatta
aaatcaagtaacagattgatttttgcaacatatactagtggagaactaacctatctcatt
tctgatgatagtggtcaaacatggaagaaatcctcagcttcaattccgtttaaaaatgca
acagcagaagcacaaatggttgaactgagagatggtgtgattagaacattctttagaacc
actacaggtaagatagcttatatgactagtagagattctggagaaacatggtcggaagtt
tcgtatattgatggaatccaacaaacttcatatggcacacaagtatctgcaattaaatac
tctcaattaattgatggaaaagaagcagtcattttgagtacaccaaattctagaagtggc
cgtaagggaggtcaattagttgtcggtttagtcaataaagaagatgatagtattgattgg
aaataccactatgatattgatttgccttcgtatggttatgcctattctgcgattacagaa
ttgccaaatcatcacataggtgtactgtttgaaaaatatgattcgtggtcgagaaatgaa
ttgcatttaagcaatgtagttcagtatatagatttggaaattaatgatttaacaaaataa

DBGET integrated database retrieval system