KEGG   Streptococcus pneumoniae Taiwan19F-14: SPT_1610Help
Entry
SPT_1610          CDS       T00875                                 

Definition
(GenBank) D-alanine--D-alanine ligase (D-alanylalanine synthetase)(D-Ala-D-Ala ligase)
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
snt  Streptococcus pneumoniae Taiwan19F-14
Pathway
snt00473  D-Alanine metabolism
snt00550  Peptidoglycan biosynthesis
snt01100  Metabolic pathways
snt01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:snt00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    SPT_1610
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SPT_1610
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    SPT_1610
Enzymes [BR:snt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SPT_1610
Peptidoglycan biosynthesis and degradation proteins [BR:snt01011]
 Precursor biosynthesis
  Amino acid ligase
   SPT_1610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: ACO23289
UniProt: C1CST6
LinkDB All DBs
Position
complement(1531519..1532562)
Genome map
AA seq 347 aa AA seqDB search
MKQTIILLYGGRSAEREVSVLSAESVMRAVNYDRFTVKTFFISQSGDFIKTQEFSHAPGQ
EDRLMTNETIDWDKKVAPSAIYEEGAVVFPVLHGPMGEDGSVQGFLEVLKMPYVGCNILS
SSLAMDKITTKRVLESAGIAQVPYVAIVEGDDVTAKIAEVEEKLAYPVFTKPSNMGSSVG
ISKSENQEELRPALELAFRYDSRVLVEQGVNAREIEVGLLGNYDVKSTLPGEVVKDVAFY
DYDAKYIDNKITMDIPAKISDDVVAVMRQNAETAFRAIGGLGLSRCDFFYTDKGEIFLNE
LNTMPGFTQWSMYPLLWDNMGISYPELIERLVDLAKESFDKREAHLI
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaacgattattcttttatatggtggacggagtgcggaacgcgaagtctctgtc
ctttcagctgagagtgtcatgcgtgcggtcaattacgaccgtttcacagtcaagactttc
tttatcagtcagtcaggtgactttatcaaaacacaggaatttagtcatgctccggggcaa
gaagaccgtctcatgaccaatgaaaccattgattgggataagaaagttgcaccaagtgct
atctacgaagaaggtgcagtggtctttccagtccttcacgggccaatgggagaagatggc
tctgttcaaggattcttggaagttttgaaaatgccttacgttggttgcaacattttgtca
tcaagtcttgccatggataaaatcacgactaagcgtgttctggaatctgctggtattgcc
caagttccttatgtggctatcgttgaaggcgatgatgtgactgctaaaatcgctgaagtg
gaagaaaaattggcttatccagtcttcactaagccgtcaaacatggggtctagtgtcggt
atttctaagtctgaaaaccaagaagaactccgtccagccttagaacttgccttccgatat
gatagccgtgtcttggttgagcaaggagtgaatgcccgtgaaattgaggttggcctcttg
ggtaactacgatgtcaagagcacgctaccaggagaagttgtcaaggatgttgccttttat
gactacgatgccaagtatattgataacaagattactatggatattcctgccaaaatcagt
gatgatgtggtggctgtcatgcgtcaaaatgcagaaacagccttccgtgccattggtggc
cttggtctatctcgttgcgatttcttctatacagataagggagagatttttctcaacgag
ctcaataccatgccaggtttcacccagtggtctatgtacccactactttgggacaatatg
gggatcagctacccagaactaatcgagcgtttggttgaccttgccaaggaaagttttgac
aagcgcgaagcgcatttgatataa

DBGET integrated database retrieval system