KEGG   Solenopsis invicta (red fire ant): 105195127Help
Entry
105195127         CDS       T03916                                 

Definition
(RefSeq) uncharacterized LOC105195127
  KO
K11429  
histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
soc  Solenopsis invicta (red fire ant)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:soc00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    105195127
Enzymes [BR:soc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     105195127
Chromosome [BR:soc03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     105195127
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 1162 aa AA seqDB search
MQRASPSPNESQRRRMVVDYCLSIQASATAVRKQERRLGGTVGAKMQPNTGGGCGMTPKE
LSDNDDLATSLVLDPYLGFTTHKMNIRYRPLKANKDELRKIICEFIQTQNYEKAYKKLMG
GDWGARLPHTKSKQQQINLENHIKRYLRVFDKDSGFAIEACYRYSLEGQKGAKICATRKW
MKHDKISCLVGCIAELSEKEEAALLHPGKNDFSVMFSCRKNCAQLWLGPAAYINHDCRAN
CKFVATGRDTACVKVLRDIEIGEEITCFYGEDFFGDSNCYCECETCERRRTGAFASQKPG
EELSSGYRLRETDNRINRTKHRQQPLNRNKQQADTALTERNTVLVGNAAVAPQSLSMKEL
RRKGLTKYDAELLIAQGCRFSDINQQQPVINNGENVLQTRAHPSMITTSVTRSLRNKQMC
KFDSNSGDGNTIKNTQSLRASRLHKRTESKKGKVGIKSASSCLSNPIVKDTEVVDIGHRK
EDSDRVPVHKENLYSRLQKHHLPNASQVDRDFCVKQSRQRTVVKESNEDACPLRLMEVQN
LGESNGDNDPVEDERGIPNLTAEVEPETVDNVNSSNYKKGHYSTNACDSIRLSSTSQIHV
QQRLHTVELIPEDTNCRSRDYHHSSSPVRHKEGMNDPCDVAEQVNCVNKRSKSHGKRLSS
TDERDDRKTPNEESSYEFEDDDLSVEEKKRLTLQADFRESDILHETSSRSDDECYDLNSA
KVIVVQKYDIEKEVESEGSESPIAIDASVASRSNSVEFCGLNSEGILETEANTENVLKCY
TVLNQEEEENIVTKSDAYVEPDVKSGMTMLCATEMDSRINVTEGNNATVFSNIQITNYHN
DIAGHTNLEDPALKRSRRKDLALDACLKSSRKLQKRLSSAKSKFGILMEGGREDSKGHGK
RKNKNKSTKSQRRDRQRSATAEIGEADDDSGIQGDIYEFSEKESNLEDIGILIRRGKHES
RHASSSSIVVSPVQEMQCNDEYNKAEPPVLIPEEPWPPSVAQSESGAESNSGLQTRGNCD
VERSLERLTAYENNGSTRKSSTTSSECQWRTSNSSDCRVCPVTPERTGGLKLTLRMKRSP
VLDDIVESGTSGLSEDSYEPEYEVLRVEGLERRKRRKKHKSRDRERRHKKSRELNLDPPP
PPMKRLRLILGNETRTIDLTHS
NT seq 3489 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgtgcatcaccaagcccgaatgaaagtcagcgtcgcagaatggtggtggactac
tgcttgtcgattcaagcctcagcaactgcagtaagaaagcaggagcgaaggttaggtggc
actgtgggtgcaaagatgcaacccaacactggtggaggatgtggaatgacacccaaagag
ctctccgacaatgacgacttggctacatccctcgtgctggatccctatctaggatttacc
actcataagatgaatatcagatacaggccgttaaaggcgaataaggacgagcttcgaaaa
atcatctgtgaatttatccaaactcaaaattatgaaaaggcatacaaaaaattgatgggt
ggtgactggggtgcgcggcttccccacacaaaatctaaacaacagcaaatcaatctagag
aatcacattaagcgatacctgcgagtttttgataaggattccggttttgccatcgaggca
tgctacagatacagcttagagggacaaaagggtgccaagatatgcgctacccgaaaatgg
atgaagcacgacaaaatttcctgtctcgtcggttgcatagcagagctcagtgaaaaggaa
gaagctgcgttgctacatcctgggaaaaatgacttctctgtgatgtttagttgtcgaaag
aattgcgctcaattatggttgggaccggcggcatatataaaccatgactgtagagcgaac
tgcaagtttgtggcgacgggaagggacacggcgtgtgttaaggtgttgcgcgatatcgag
ataggtgaagaaatcacctgcttctacggagaagatttctttggtgatagcaactgttac
tgcgagtgtgagacttgcgagaggcgaagaaccggtgcttttgcgagccagaagccgggc
gaggagttatcgtctggttatcgtttgagagaaacagacaatcgaatcaatcgaaccaag
catcgacagcagccattgaacaggaataagcagcaagccgataccgctctcaccgagcga
aacacggttcttgtcggaaatgcggcagtcgcgccgcagtcactcagtatgaaagagttg
cggcgcaaagggctcacaaagtatgatgccgagctgctgatcgcgcaaggctgtcgtttc
tcggatatcaatcagcagcagccggtgatcaataacggcgagaatgtgctacaaactcga
gctcatccttccatgatcacaacttccgtcacgaggagtctccgtaacaaacaaatgtgc
aagttcgacagcaattctggtgacggaaacaccatcaagaatactcagtcgctcagagcg
tccagacttcacaagagaacggagtcaaagaaagggaaagtcggtataaagtctgcatcg
tcctgtcttagtaatcccattgtgaaagacacggaagtggtagatatcggtcatcgaaag
gaagactctgatagagtaccagtgcacaaggagaatttgtattcgcgactgcaaaagcat
catctgccgaacgcatcgcaggtagatcgcgatttctgcgtgaaacaatcacggcagcgt
accgtggtaaaggaatcaaacgaggacgcctgtccgctgcgactgatggaggttcaaaac
ctcggtgaatcgaacggtgataacgacccggtggaagacgaacggggaataccgaatctc
accgcagaggtcgagcctgagacagtagataacgttaattcttccaattacaaaaaggga
cattatagtacaaacgcctgtgattcaatccgattaagttccacgtctcaaatccatgta
caacaacgcttacataccgtagaattgattcccgaggatacgaattgtcgttcgagggac
taccatcattcttcatcgcccgttcggcataaggaaggcatgaacgatccttgtgacgtg
gctgaacaggtgaattgcgttaacaaacgttctaaatcccatggtaagcgactttcttcg
acggacgagcgagacgatcgcaagacgccgaacgaggagtcgtcttatgaatttgaagat
gacgatttgtcggttgaggaaaagaaaaggctaacgttgcaggctgatttccgagagagt
gacattttacacgaaacgagctctcggtcggatgacgaatgttacgatttaaactccgcg
aaagtaatcgtggtgcaaaagtatgatatagaaaaggaagtggagagtgaaggctccgag
agtccgatcgccatcgacgcatcggtggcgagtcgctcaaacagtgtagagttttgtgga
ttgaactctgaaggaattttagagacagaagctaataccgaaaacgttttaaaatgttat
acagttttgaaccaggaggaagaagagaatattgtgacgaaaagtgatgcgtatgtcgag
cctgacgtaaaatccgggatgacgatgttatgcgcgacggaaatggactccagaataaat
gttacggaaggaaataacgcgacggtctttagtaacatacagattacgaactatcataac
gatatagctggtcacacgaatttggaggatcccgcgttaaagagatctagacgaaaagat
ctcgctttagacgcgtgtttgaagtcgtctcgcaagttgcaaaagaggctctcgagcgcc
aagtccaagtttggaattttaatggaaggtgggagggaagattcaaagggtcatggcaag
aggaagaacaagaacaaatctacaaagagtcagaggagagatcggcagagatcggcgaca
gccgagataggggaggctgatgacgattcaggcatccagggcgatatctatgagtttagt
gagaaagagagcaatctggaagatattggcatattgataagacgcggcaaacacgaatct
cgccacgcatcttcctcctcaatagtggtgtcaccggtacaggagatgcaatgcaatgac
gagtacaataaagccgaaccgccagtgctgatcccggaggaaccgtggcctccatccgtg
gctcagagtgaatctggcgcggaatccaatagtggtcttcagacgagaggaaactgtgat
gtcgaaaggagtttggagcgattgacagcttatgaaaataatggcagtacgcgaaaatca
agcacaacctcgtccgagtgccaatggcgaacgagcaattcgagcgattgtcgagtttgc
cctgtcacaccggagaggaccggtggactgaagctgaccttgcgcatgaaacggtcgccg
gtgctagacgatatcgtagagtctggcaccagcggcctgagtgaggacagctacgagcca
gagtatgaggtgttgcgcgtcgagggactggagaggcgcaaacgccgaaagaagcacaag
agcagggatcgcgagagacggcataagaaatcgcgcgaattgaacctcgacccgccgcca
ccgcccatgaaaagattacgcttgattctcggcaacgagacacgcaccatcgatttaacg
cactcttaa

DBGET integrated database retrieval system