KEGG   Solenopsis invicta (red fire ant): 105198043Help
Entry
105198043         CDS       T03916                                 

Definition
(RefSeq) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
soc  Solenopsis invicta (red fire ant)
Pathway
soc00500  Starch and sucrose metabolism
soc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:soc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    105198043
Enzymes [BR:soc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     105198043
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase Alpha-amylase_C
Motif
Other DBs
NCBI-GeneID: 105198043
NCBI-ProteinID: XP_011162987
LinkDB All DBs
Position
Un
AA seq 491 aa AA seqDB search
MMRALVCVLAILSVVAAQKELYYAPGHDGMVHLFEWKWPDIADECERFLGPMGFGSVQVS
PVQENLMIGNRPWWERYQPISYIWHTRSGTPDEFKKMVRRCNDAGVRIIVDVVFNHMSGN
WDNAKGTGGSTADTHNFNYPAVPYSRSDFHNPCAITNYKDAANVRNCELSGLHDLDQGNE
YVKEKIVNFLNQLIEAGVAGFRVDAAKHMWPSDLKVIYSRLKNLNTDHHFPSNARPFITQ
EVIDYGGEAVSKYEYNSFGTVTEFRFGMEISNAFKGNNLLKWFTNWGEAWGLLPSKDALV
FIDNHDTQRGNPNILTHKSPKLYKMAVAFMLAHPYGIPRIMSSFYFDSFDATPPQDSNGN
LRSPIINSDNTCGNGWVCEHRWRQIYNMVGFRNAANHTGINNWWDNGQNQIAFCRGDAAF
IAINADRYDMKQTLVTCLPPGTYCDVISGNLENNKCTGKVVTVGQDKKAYIEIVSNQDDG
VLAIHQGAKLN
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgagctctagtgtgtgtgttagcaatcctatcggtggtagccgctcaaaaagag
ctgtactatgcacccggtcatgatggaatggtgcatctttttgaatggaaatggccggac
attgcggatgaatgtgaaagattcctcggtcccatgggattcggtagcgtgcaagtttct
ccggtccaagaaaatctaatgataggcaacagaccatggtgggaacgctaccagcctata
tcctatatctggcatacgaggtcgggcacgccggacgaattcaagaagatggttcgcagg
tgtaatgacgccggcgtgaggattatcgtcgacgtggtgttcaaccacatgtccggcaat
tgggataacgcaaagggtaccggcggttcgacagcggatactcataacttcaattatccg
gcggtgccatattcccgctccgatttccataatccttgcgctatcactaattataaggac
gcagcaaatgtgcggaattgcgagttgtccggtctgcacgatctcgatcagggaaacgaa
tatgttaaggagaagatcgttaattttttgaatcaattaatcgaggctggagtcgctggt
tttcgagtagatgcagctaaacatatgtggccgagtgacctaaaagtgatatactctcgg
ttgaaaaatctcaatactgatcatcatttcccttcaaacgcgcggcctttcataactcaa
gaagtgatcgattacggtggcgaagcggtcagtaaatatgaatacaactcttttggcacg
gtgacggaattccgattcggtatggagatcagcaacgccttcaagggaaacaatctccta
aaatggtttaccaattggggagaagcttggggtctattaccatccaaagatgctttggtc
tttattgacaatcatgatactcagcgtggcaatcccaacatactcacccacaaatcaccg
aaactttacaagatggccgttgcttttatgctggcgcatccttatggaatcccgcgcatc
atgagttccttctactttgatagcttcgacgccactccgcctcaggactccaacggtaat
ctccggtctccgattatcaattctgacaatacctgcggcaacggctgggtctgcgagcat
cgatggcgtcagatctacaacatggtgggcttccgaaacgccgcaaatcataccggcatc
aacaactggtgggacaatggccagaatcaaattgccttctgtcgtggagatgcggcattc
attgcgattaatgctgatcgttacgacatgaaacagactcttgtcacttgtctgccgcct
ggcacttattgcgacgttatctctggaaatttggagaataacaagtgcactggtaaggtc
gtaactgtgggtcaagataaaaaggcgtacatagaaatcgtttcaaaccaggacgatgga
gtactcgccattcatcaaggggcaaagttgaactaa

DBGET integrated database retrieval system