KEGG   Sodalis praecaptivus: Sant_0102Help
Entry
Sant_0102         CDS       T03004                                 

Gene name
sodA
Definition
(GenBank) Manganese superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
sod  Sodalis praecaptivus
Brite
Enzymes [BR:sod01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Sant_0102 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(114799..115416)
Genome map
AA seq 205 aa AA seqDB search
MSFTLPSLPYGYDALEPHFDKETMEIHHTKHHQTYVNNANGALESLPEFANLPVDDLIQK
LDQLPADKKTVLRNNAGGHANHSLFWKGLKQGTTLQGELKSAIERDFGSVDAFKEAFEKA
AATRFGSGWAWLVKKDGKLAVVSTANQDNPLMGEAISGTSGYPILGLDVWEHAYYLKYQN
RRPDYIKSFWNVVNWDEAAARFSHA
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgagctttacgctaccttccctgccttatggctatgacgccctggaaccgcatttcgac
aaagaaacgatggaaattcatcacactaaacaccatcagacctatgtcaacaacgccaac
ggcgccctggaaagcctgccggaattcgccaatttgccggtcgacgacctgattcaaaaa
ctagaccagctcccggcggacaaaaagaccgtattgcgcaataacgccggtggtcatgcc
aaccatagtctgttctggaagggtctgaagcaaggcaccaccttgcagggcgaattgaaa
agcgctatcgagcgtgatttcggcagcgttgacgccttcaaagaggcgttcgagaaagcc
gccgcgacccgtttcggttccggctgggcctggcttgtgaaaaaagacggcaaattggcc
gtggtgtccaccgccaaccaggacaacccgctgatgggcgaagcgatttccggtacctcc
ggctacccgattttgggcctggacgtctgggagcacgcttattacttgaaatatcagaac
cgccgcccggactacatcaagtcattctggaacgtggtgaactgggatgaagcggccgcg
cgttttagccacgcctga

DBGET integrated database retrieval system