KEGG   Sodalis praecaptivus: Sant_0419Help
Entry
Sant_0419         CDS       T03004                                 

Gene name
tufA
Definition
(GenBank) Elongation factor Tu (EF-Tu)
  KO
K02358  
elongation factor Tu
Organism
sod  Sodalis praecaptivus
Brite
Translation factors [BR:sod03012]
 Eukaryotic Type
  Elongation factors
   Sant_0419 (tufA)
 Prokaryotic Type
   Sant_0419 (tufA)
Mitochondrial biogenesis [BR:sod03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Sant_0419 (tufA)
Exosome [BR:sod04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Sant_0419 (tufA)
  Exosomal proteins of breast cancer cells
   Sant_0419 (tufA)
  Exosomal proteins of colorectal cancer cells
   Sant_0419 (tufA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
473481..474665
Genome map
AA seq 394 aa AA seqDB search
MSKEKFQRTKPHVNVGTIGHVDHGKTTLTAAITTVLAKAYGGSARAFDQIDNAPEEKARG
ITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFMNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPVIRGSALKALE
GDEAWTQKIIELAEALDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIVKVG
EEVEIVGIKDTTKTTCTGVEMFRKLLDEGRAGENVGVLLRGTKRDDVERGQVLAKPGSIK
PHTQFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMV
VNLIAPIAMDDGLRFAIREGGRTVGAGVVAKVIA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgtctaaagaaaagtttcaacgcaccaaaccccacgttaacgtcggtactatcggccac
gttgaccatggtaaaacgaccctgaccgccgccatcaccaccgttctggccaaggcctac
ggcggtagcgcgcgcgcgttcgatcagatcgacaacgcgccggaagaaaaggcccgtggt
atcaccatcaacacttcgcacgttgaatacgataccccgacccgccactacgcgcacgta
gactgccctgggcacgccgactatgtgaaaaacatgatcaccggcgcggcccagatggac
ggcgcgatcctggttgtagccgccaccgacggcccgatgccgcagacccgtgagcacatc
ctgctgggtcgccaggttggcgtaccttacatcatcgtgttcatgaacaaatgcgacatg
gttgatgacgaagagctgctggaactggtggaaatggaagtgcgcgaactgctgtcgcag
tacgacttcccgggcgatgacacgccggttatccgcggttccgcgctgaaagcgctggaa
ggcgacgaagcctggacgcagaaaatcattgaactggcggaagcgctggacagctacatt
ccggaaccggaacgcgccatcgacaagccgttcctgctgccgatcgaagacgtattctcc
atctccggccgcggcaccgtggtaaccggtcgtgtagagcgcggcatcgtcaaagtgggt
gaagaagtggaaatcgtcggcatcaaagacaccaccaaaaccacctgcaccggcgttgaa
atgttccgcaaactgctggacgaaggccgtgccggcgagaacgttggcgtgctgctgcgc
ggcaccaagcgtgacgacgtcgagcgtggtcaggttctggccaagccgggctcgatcaag
ccgcacacccagtttgaatcggaagtgtatattctgagcaaagacgaaggcggtcgccac
acgccgttcttcaaaggctaccgtccgcagttctatttccgtaccactgacgtgaccggt
accatcgaactgccggaaggcgttgaaatggtgatgcctggcgacaacatcaagatggtt
gttaacctgattgccccgatcgccatggacgacggtctgcgtttcgctattcgcgaaggc
ggccgtaccgttggcgccggcgttgttgccaaagttatcgcttaa

DBGET integrated database retrieval system