KEGG   Shewanella oneidensis: SO_1576Help
Entry
SO_1576           CDS       T00099                                 

Gene name
yfcG
Definition
(RefSeq) disulfide reductase YfcG
  KO
K11209  
GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
son  Shewanella oneidensis
Brite
Enzymes [BR:son01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     SO_1576 (yfcG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1653523..1654191)
Genome map
AA seq 222 aa AA seqDB search
MIDLYTAATPNGFKISIALEEMGLDYRVHKLDFSTNEQKQPEFLAINPNGRIPAIIDRDN
DDFVVFESGAILLYLAEKTGQFLPADPKKRSQVIQWLMFQMSGVGPMMGQANVFYRYFPE
KIPAAIERYQKEGRRLFEVMDTQLAKHQYLAGDEYTIADIATWPWVRIHEWSGINMVGLS
HLQRWLDELALRPACQKGIVTPPPAIMTDEERAKQIQKMVTK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgattgatttatataccgccgctaccccaaacggctttaaaatctccatcgcactcgaa
gaaatggggctcgattatcgagtacataagttagatttcagcaccaacgaacaaaagcag
cccgagtttctagccattaaccctaatggccgtattccagcgattattgacagagataac
gatgactttgtggtgttcgaatctggtgcgatcctgctttatctggcggaaaaaaccggt
caatttctacctgccgatccgaaaaaacgctctcaagtcattcaatggctgatgttccag
atgagcggcgttggccctatgatgggtcaagcgaacgtattctaccgttacttccctgaa
aaaatccctgcagcgatagaacgttaccaaaaagaaggtcgacgtttgtttgaggtaatg
gacactcaattagccaaacatcaatatcttgcgggtgatgaatacactattgccgatatt
gcgacttggccttgggtacgtatccatgaatggagtggtatcaatatggtaggtctatcc
cacttacaacgttggttagacgaattagccctgagacccgcatgccaaaagggcattgtg
accccgccacccgccataatgacggatgaagagcgtgcaaagcaaattcaaaagatggtg
actaagtaa

DBGET integrated database retrieval system