KEGG   Shewanella oneidensis: SO_2494Help
Entry
SO_2494           CDS       T00099                                 

Definition
(RefSeq) peptidase family M2
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
son  Shewanella oneidensis
Brite
Enzymes [BR:son01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     SO_2494
Peptidases [BR:son01002]
 Metallo Peptidases
  Family M2
   SO_2494
Exosome [BR:son04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SO_2494
CD molecules [BR:son04090]
 Proteins
  SO_2494
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2618929..2620788
Genome map
AA seq 619 aa AA seqDB search
MAILLNRPTTLALTIALTLNLTACNNKQNTSETKTSIPASTSTPDKAQAIAFIQDAEAQM
AQLSIEANRAEWIYSNFITEDTAALSAAVGEKVSAASVKFATEAAKYANVELDPANARKL
NILRSALVLPAPLDPAKNAELAQISSELNGLYGKGKYCFADGKCMTQPELSSLMAESRDP
AKLLEAWKGWREIAKPMRPLFQREVELANEGAKDLGYANLSELWRSQYDMKPDEFSQELD
RLWSQVKPLYESLHCYVRGELNKEYGDAIAPKTGPIPAHLLGNMWAQQWGNVYDLVAPEN
ADPGYDVTELLAQKGYDEHRMVKQAESFFTSLGFAPLPDSFWSRSLFLQPKDRDVVCHAS
AWDLDNLDDIRIKMCIQKTAEDFTVIHHELGHNFYQRAYKQQPFLFKNSANDGFHEAIGD
TIALSITPSYLKQIGLLEEVPDASKDIGLLLKQALDKIAFLPFGLMIDQWRWKVFSGEIT
PAQYNQAWWELREKYQGVKAPTPRSETDFDPGAKYHVPGNVPYTRYFLAHILQFQFHKAL
CETAGDKGPVHRCSIYGNQAAGEKLNRMLELGSSQPWPMALKEVTGTETMDANAVLDYFA
PLKTWLDEQNKAANRQCGW
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atggctattctattgaatcgtcccacaactctagcactcaccatagcgttaacattaaac
ctaactgcttgtaataataaacaaaatacttcagaaactaagacttctatacctgctagt
acaagtacacctgataaagctcaagccattgcctttattcaagatgctgaagcgcaaatg
gcgcagttatccattgaagcgaatcgtgccgaatggatttatagcaatttcatcaccgaa
gataccgccgcattatcggccgcagtgggtgaaaaagtcagcgctgcgtccgtcaagttc
gccactgaagccgcaaagtatgccaatgttgaacttgatcccgctaatgcccgcaaacta
aatattctacgtagcgcattagtgttaccggcgccacttgaccccgccaaaaatgctgag
ctggcacagataagttctgagctcaatgggctctacggtaaaggcaaatactgtttcgcc
gatggcaaatgtatgacgcaacctgagctgtcttccctcatggcggaatcacgggatccc
gccaaattacttgaagcttggaaaggttggcgtgaaatagctaaaccaatgcgcccgcta
tttcaacgtgaagtcgaactcgccaacgaaggcgcaaaagacttaggttacgctaacctt
tctgagttatggcgcagccaatatgatatgaaacctgatgaattctctcaggaattagac
cgtttatggagccaggttaaaccactttacgaatccttgcattgttatgtgcgtggtgag
ttgaacaaagaatatggtgatgccattgccccgaagacgggtccaattccggcacactta
ctagggaatatgtgggctcagcaatggggtaatgtgtatgatctggtggcgcccgagaat
gctgaccctggttatgatgtgaccgagctactcgcgcagaaaggctatgacgagcacaga
atggtgaaacaagccgaaagctttttcacctctttgggctttgcgccgctgcctgacagt
ttttggagccgctctttattcttacaacccaaagatcgcgacgtagtgtgtcatgcctcg
gcatgggatctggataacctcgatgatatccgcatcaaaatgtgtatccaaaaaaccgct
gaagacttcaccgtcattcaccacgaacttggccataacttctaccaacgcgcctacaag
cagcagcctttcctatttaaaaacagcgccaatgatgggttccatgaagccattggcgac
accatcgcgctgtctatcacaccaagttatctcaagcagataggcttactcgaagaggta
cccgacgcttcaaaggatattggtttattgcttaagcaagccttagataaaatcgctttt
ctgccttttggtctaatgatcgaccaatggcgttggaaggtatttagcggtgaaatcacc
cctgcccaatataaccaagcgtggtgggagctgagggaaaaatatcaaggtgttaaagcg
ccgacaccgcgaagtgagaccgattttgatccaggtgcaaaataccatgtacctggcaat
gtgccttacacccgttatttcctcgcccatattttgcaattccagttccacaaggcgctg
tgtgaaactgcaggcgataaaggaccagtgcatagatgcagcatttacggcaatcaagct
gcaggagaaaaacttaatagaatgttagagttgggctcgagtcagccatggcctatggct
ttaaaggaagtaacaggcactgaaaccatggacgcgaacgctgtactcgattattttgcg
ccgctcaaaacctggcttgatgagcagaacaaggctgcgaatcgtcaatgcggctggtaa

DBGET integrated database retrieval system