KEGG   Solanum tuberosum (potato): 102604298Help
Entry
102604298         CDS       T02981                                 

Definition
(RefSeq) DNA ligase 1-like
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
sot  Solanum tuberosum (potato)
Pathway
sot03030  DNA replication
sot03410  Base excision repair
sot03420  Nucleotide excision repair
sot03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:sot00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    102604298
   03410 Base excision repair
    102604298
   03420 Nucleotide excision repair
    102604298
   03430 Mismatch repair
    102604298
Enzymes [BR:sot01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     102604298
    6.5.1.6  DNA ligase (ATP or NAD+)
     102604298
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     102604298
DNA replication proteins [BR:sot03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    102604298
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     102604298
DNA repair and recombination proteins [BR:sot03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     102604298
   NER (nucleotide excision repair)
    Other NER factors
     102604298
   MMR (mismatch exicision repair)
    Other MMR factors
     102604298
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 102604298
NCBI-ProteinID: XP_006349032
LinkDB All DBs
Position
Un
AA seq 802 aa AA seqDB search
MLCLSSYRFTQTTLLYNFSLKPSSSIFLHFSKKKQFPLKPLFFSVNPNSRTMSDSPPTPP
PPRSAFAVLMANSKKKTTSSPKKRKTPDVETSSKSPVVNQDSVLMPIKDTHLVNESKSEE
VVVKKRNQDSILKPIEDTHLVNESKSEECVVKKRKMISPDESIVEIKKKAANFDPKKAVY
WGDGQRVPFMFVVKAFDAISKESGRIVITEIVTNMLRTVIETTPEDLLPVVYLAANKIAA
AHDGMELGIGDASIIKALAEACGAKEAHIKKQYKELGDLGLVAKASRSSQPLMHKPEALT
VAKVFDTFRIIAKESGKDSQEKKKNYIKSLLVAATDCEPQYLIRLLQTKLRIGLAEQTLL
VAIAHAFVYSDKHSSPPAGVDSPLEEAAKIVKQVFSVIPVYEKIVPALLADGVWKLSETC
GFSPGVPVGPMLAKPTKGVSEILDKFQDMEFTCEYKYDGERAQIHYMEDGSVEIYSRNAE
RNTGKFPDVVTAISRLKKSSATSFVLDCELVAYDREKQKILPFQVLTTRARKNVVISEIK
VNVCIYAFDILYLNGQPLLQEQLNVRREHLYKSFEEEPGYFQFATAVASNDLEEITKFLE
DAVNGSCEGLIIKTLTKDATYEPSKRSNNWLKLKKDYMESIGDSLDLVPIGAFHGRGKRT
GVYGAFLLACYDSNNEEFQSICKIGTGFSEVELEERSSSLRSKVIPKPKSYYRYAETINP
DVWFEPTEVWEVKAADLTISPVHRAAQGIVDPEKGISLRFPRLSRVREDKKPEEASSADM
VADMYNAQKHNQKSNQDGNDED
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atgttgtgtttgagttcatatcgtttcactcaaaccactcttctttacaatttctccctt
aaaccttcttcttcaatctttcttcacttctccaagaagaagcaattccctctcaaaccc
cttttcttctctgtaaaccctaattcaagaaccatgtctgattctcctcctactcctcct
cctcctcgctctgcgtttgctgtccttatggcaaattccaagaagaaaacaacctcctca
cccaagaaacgtaaaaccccagatgttgaaacttcaagtaaaagccctgttgttaatcaa
gattcagttttgatgccaattaaggacacccatttggtcaatgagtcgaaaagtgaggag
gtggtggtgaagaaacggaatcaagattcaattttgaagccaattgaggacacccatttg
gttaatgagtcgaaaagtgaggagtgtgtggtgaagaaacggaaaatgattagtccagat
gagagcattgtggaaataaagaaaaaagctgcaaattttgatccaaaaaaggctgtatat
tggggggatgggcagagagtgccgttcatgtttgtagttaaggcgtttgatgcaatttcg
aaggagtcagggaggattgttattactgagattgtgactaatatgttgaggactgtgatt
gagacgacgcctgaggatttgttgcctgttgtgtaccttgctgctaacaagattgcagct
gcacacgatgggatggagcttggtattggtgatgcttccattatcaaggcacttgctgaa
gcctgtggtgctaaagaagcacatatcaagaagcaatacaaggagcttggagatttgggc
cttgttgcaaaagcaagtcgttcatcacagcctctgatgcataaaccagaagcactgact
gttgccaaagtttttgacacatttcgaatcattgccaaggaatctggaaaggatagtcag
gaaaagaaaaagaattacattaaatcactgcttgttgcagccactgattgtgaaccccaa
tatttgattcgtcttctccagacaaagctacgcattggtttggctgaacaaacactgtta
gtcgcaatcgctcatgcttttgtgtactcagataagcattcatcacctcctgcaggtgta
gattctcctttggaagaggccgccaagattgtaaagcaagtgttctctgtgattccagtt
tatgaaaaaattgtccctgctcttctagctgatggtgtttggaagctttcagaaacatgt
ggtttctcacctggtgttccggttggacctatgctagctaagccaaccaaaggagtatct
gaaattcttgataagtttcaggatatggagttcacatgtgaatacaagtatgatggtgaa
cgtgctcagatacactacatggaagatggttctgttgagatatatagccgaaatgcagaa
agaaatactggaaagtttcctgatgttgttactgctatctcaagattgaagaaatcttct
gcaacttcatttgttcttgactgtgaactggttgcatacgaccgtgagaaacagaagatc
ctgccctttcaggtccttactacacgtgctcgtaaaaatgttgtcattagtgaaatcaag
gtcaacgtgtgcatatatgcttttgatatcttgtatcttaatggacagccacttcttcaa
gagcaacttaatgttcgcagagagcatctttacaagtcatttgaagaagaacctggatat
ttccagtttgctacagctgtagcctcaaacgatcttgaggaaataacaaaatttcttgaa
gatgcggtcaacggcagttgtgagggattgattatcaaaacactaactaaagatgctaca
tatgagccttcaaaacggtcaaataactggctaaaactgaagaaggattacatggagagt
attggcgactcactggatctggtaccaattggtgcttttcatggtcgggggaaacgtact
ggtgtttatggagcctttctcctagcttgttatgatagcaacaacgaggagtttcagagc
atctgtaaaatcggaactggattttctgaagtagagcttgaggaacgctcttccagcctt
cgttctaaagttattcctaaaccaaagtcatattacaggtatgctgaaaccatcaatcca
gatgtatggtttgaacctactgaggtctgggaagtgaaagctgctgatcttactatcagc
cctgtccaccgtgctgcccaaggtatcgtggatcccgagaagggaatttcattacgattt
ccccgtctgagccgtgtacgagaagacaagaagcctgaggaggcctcatcagcagatatg
gtagcggatatgtataacgctcagaaacacaatcaaaaaagcaatcaggatggcaatgat
gaagactaa

DBGET integrated database retrieval system