KEGG   Streptococcus pyogenes MGAS10394 (serotype M6): M6_Spy1524Help
Entry
M6_Spy1524        CDS       T00191                                 

Definition
(GenBank) Alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
spa  Streptococcus pyogenes MGAS10394 (serotype M6)
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:spa00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    M6_Spy1524
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    M6_Spy1524
Enzymes [BR:spa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     M6_Spy1524
Peptidoglycan biosynthesis and degradation proteins [BR:spa01011]
 Precursor biosynthesis
  Racemase
   M6_Spy1524
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1522050..1523150)
Genome map
AA seq 366 aa AA seqDB search
MISSFHRPTVARVNLQAIKENVASVQKHIPLGVKTYAVVKADAYGHGAVQVSKALLPQVD
GYCVSNLDEALQLRQAGIDKEILILGVLLPNELKLAITRQVTVTVASLEWLAMAKQEWPD
LKGLKVHIKIDSGMGRIGLRSVTEVDNLIAGLKSMGADVEGIFTHFATADEADDTKFNQQ
LQFFKKLIAGLEDKPRLVHASNSATSIWHSDTIFNAVRLGIVSYGLNPSGSDLSLPFPLQ
EALSLESSLVHVKMISAGDTVGYGATYTAKKSEYVGTVPIGYADGWTRNMQGFSVLVDGQ
FCEIIGRVSMDQLTIRLSKAYPLGTKVTLIGSNQQKNISTTDIANYRNTINYEVLCLLSD
RIPRIY
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgatttcaagtttccatcgcccaacagttgcaagggtcaacttacaagctattaaggag
aatgttgccagtgttcaaaagcatattccactaggggtaaaaacgtatgcagttgtcaag
gctgatgcttatggtcatggtgctgtccaggtgtcaaaagcactcctacctcaagtggat
gggtactgtgtgtcaaatcttgatgaggctttgcaattacgtcaagcaggtattgataaa
gagattttaattcttggggttttgctgccaaatgagctaaagttggcgattactcgccag
gttacagtgacagtggctagtttagagtggctggcgatggccaagcaagaatggccagat
ttgaaagggcttaaggtccatatcaaaattgattcaggcatgggacgaatcgggcttcgc
tcagtaacagaagttgataatctgattgctggcttgaagagcatgggtgctgatgtagaa
ggtatttttactcattttgccacagctgatgaggcagatgatactaaatttaaccagcag
ttacagttttttaaaaagctaatagctggacttgaggataagcctcgtttagtacatgct
agtaattcagccacaagtatctggcatagtgataccatttttaatgctgttcgtttagga
attgtcagttatggtttgaatccaagtggttctgatctaagcttaccatttccactgcaa
gaggctttatctctagaatctagcttagtgcatgtcaagatgatttcagctggtgataca
gtcggttatggagctacttatactgccaaaaagtctgaatatgtagggaccgtcccaatc
ggttatgcagatggctggaccaggaacatgcaaggcttttcggtgttagttgatggacaa
ttctgtgaaattatagggcgtgtatcgatggatcaactgaccatacgactttccaaagca
tatcctttaggaacaaaagtcactttgattggcagcaatcagcaaaaaaatatttctaca
acagatatcgcaaattaccgtaatacaatcaattatgaagttctatgccttttaagtgac
cgtattcctcggatatattaa

DBGET integrated database retrieval system