KEGG   Staphylococcus pasteuri: STP1_0553Help
Entry
STP1_0553         CDS       T02889                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
spas  Staphylococcus pasteuri
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spas00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    STP1_0553
Enzymes [BR:spas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     STP1_0553
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(617895..618494)
Genome map
AA seq 199 aa AA seqDB search
MYETYHSGWIECITGSMFSGKSEELIRRLRRGIYAKQKVIVFKPAIDDRYHKEKVVSHNG
NAIEAINISTAREILNHDLSHADVIGIDEVQFFDENIVSIIQQLADQGHRVIVAGLDMDF
KGEPFEPMPKLLALSEHVTKLQAVCAVCGGPSSRTQRLIDGQPAKADDPIILVGANESYE
PRCRAHHIVAPSENEKEEM
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgtatgaaacttatcattccggatggattgaatgtattaccggaagtatgtttagtggt
aaatcagaggaacttatacgtcgacttagacgagggatttatgctaaacagaaagttatt
gtttttaaaccagcaattgatgatcgctatcataaagaaaaggtagtttcacataatggc
aatgcaattgaagctataaatatttcaacagctagagaaattttaaatcatgacttatct
catgcagatgttatcggcattgatgaagttcaattttttgatgaaaatattgtaagtatc
atacaacaacttgctgatcaaggtcatcgagtcattgtggctggattagatatggacttt
aaaggcgaaccgtttgagccaatgcctaaattattggctttaagtgagcatgttacaaaa
ttgcaagctgtatgtgcggtatgtggaggcccttcaagtcgaacacaaagacttatcgat
ggtcaacccgctaaagcagatgatccaattattttagtaggtgctaatgaaagttatgaa
ccaagatgtagagcgcatcatattgtagcgccaagtgaaaatgagaaggaggaaatgtag

DBGET integrated database retrieval system