KEGG   Serratia proteamaculans: Spro_4783Help
Entry
Spro_4783         CDS       T00595                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
spe  Serratia proteamaculans
Pathway
spe00620  Pyruvate metabolism
spe00680  Methane metabolism
spe01100  Metabolic pathways
spe01120  Microbial metabolism in diverse environments
spe01200  Carbon metabolism
Module
spe_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:spe00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Spro_4783
  Energy metabolism
   00680 Methane metabolism
    Spro_4783
Enzymes [BR:spe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Spro_4783
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ABV43876
JGI: Spro4783
UniProt: A8GL86
LinkDB All DBs
Position
5298888..5301524
Genome map
AA seq 878 aa AA seqDB search
MNEQYSAMRSNVSMLGKLLGDTIKEALGEHILDRVETIRKLSKSSRAGNEAHRQELLSTL
QNLSNDELLPVARAFSQFLNLTNVAEQYHSISPNGEAASNPEALAQLFTRLKDKKLSTKE
LQNAVSQLSIELVLTAHPTEITRRTLIHKLVEVNTCLSQLDHNDLADYERNKIMRRLRQL
VAQSWHTDEIRKHRPSPIDEAKWGFAVVENSLWEGVPAFLREFNEQLENSIDYSLPAEAV
PVRFTSWMGGDRDGNPNVTAEITRHVLLLSRWKACDLFTRDIQVLVSELSMTECTPELRA
RAGGDEVQEPYREIMKQLRSQLMSSQAYLEGRLKGERVLKPHDLLVNNEQLWEPLFACYQ
SLQACGMSIIANGQLLDTLRRVRCFGVPLVRIDVRQESTRHTEAIAELTRYLGLGDYESW
SEADKQAFLIRELNSKRPLVPLKWEPSADTQEVLETCRVIAEAPQGSIAAYVISMARTPS
DVLAVHLLLKEAGCPFALPVAPLFETLDDLNNADDVMTQLLNIDWYRGFIQGKQMVMIGY
SDSAKDAGVMAASWAQYRAQDALIKTCEKAGVALTLFHGRGGSIGRGGAPAHAALLSQPP
GSLKGGLRVTEQGEMIRFKFGLPEVTISSLALYTGAILEANLLPPPEPKKEWRALMDDLS
DTSCKMYRGYVRENPEFVPYFRAATPELELGKLPLGSRPAKRKPNGGVESLRAIPWIFAW
TQNRLMLPAWLGAGAGLQEAVKAGKQDQLEAMCRDWPFFSTRIAMLEMVFAKADLWLAEY
YDQRLVDKSLWPLGQQLRDQLASDIKVVLTIANDAHLMEDLPWIAESIALRNVYTDPLNV
LQAELLHRSRQQEQPDARVEQALMVTIAGVAAGMRNTG
NT seq 2637 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattcggcaatgcgaagtaatgtcagtatgctcggcaaattgctcggc
gataccatcaaagaagcgctgggcgagcatattctcgatcgcgttgaaactatccgtaag
ctttccaaatcttcacgtgcaggtaacgaagcgcatcgccaggagctgctttctaccttg
caaaacctgtccaacgacgagttgctgccggtcgcacgcgccttcagccagtttcttaat
ctgaccaacgtcgccgagcagtaccacagcatttcacccaatggcgaagccgccagcaac
ccggaagcgctggcgcagttgttcacccggctgaaagacaaaaagctcagcaccaaggag
ctgcaaaatgcggtgtcacagctgtccatcgaactggtgctgaccgcgcacccgacggaa
atcactcgccgcaccctgatccacaagctggttgaggtcaacacctgcctcagccaactc
gaccataacgatctggccgactacgagcgcaacaagatcatgcgccgtctgcgccaattg
gtggcccagtcctggcataccgacgagatccgcaaacatcgtccctccccgatcgacgaa
gccaagtggggctttgcggtggtggaaaacagcctgtgggaaggggtgcctgccttcctg
cgcgaattcaacgaacagttggaaaactccatcgattacagcctgccggcggaagcggtg
ccggtacgtttcacctcctggatgggaggtgaccgcgacggcaaccctaacgtgacggct
gaaattacccgccatgtactgctgctcagccgttggaaggcctgcgacctgttcacccgc
gatattcaggtgctggtgtccgagctgtcgatgaccgaatgtaccccggaactgcgtgca
cgggccggtggcgatgaagtgcaagagccgtaccgcgaaatcatgaaacaactgcgcagc
cagttgatgagctctcaggcttatctggaaggtcgcctgaagggtgagcgcgtactgaaa
ccgcacgacctgctggtgaataacgaacagctgtgggaaccgctgttcgcctgttaccag
tcgctgcaggcctgtggcatgagcatcatcgccaatggccagttgctcgataccctgcgt
cgcgtgcgctgctttggcgtgccgctggtgcggatcgacgtgcgtcaggaaagtacccgc
cacaccgaagccatcgccgaattgacccgctatctggggctgggcgactacgaaagctgg
tcggaagccgacaaacaggcgttcctgatccgcgaactgaactccaaacgcccgctggtg
ccactaaaatgggagccgagtgccgacacccaggaagtgctggaaacctgtcgggtgatc
gccgaagcgccacagggttcgattgccgcctatgtgatttccatggctcgcacgccttct
gacgtgctggcggttcacctattgctgaaagaagccggttgcccgttcgccctgccggtg
gccccactgttcgaaaccctcgacgacctgaacaacgccgacgacgtaatgacccagttg
ctgaatattgactggtaccgcggctttatccagggcaaacagatggtgatgattggctat
tccgactcggcaaaagatgccggagtgatggcagcctcctgggcgcagtaccgcgcgcaa
gacgcactgatcaaaacctgtgagaaagccggcgtggcgctgacattgttccacggtcgc
ggcggctcgattggccgtggtggcgccccggcgcatgcggcactgctgtcgcaaccaccg
ggcagcctgaaaggcggcctgcgcgtcaccgaacagggtgagatgatccgcttcaaattt
ggcctgccggaagtcaccatcagcagcctggcgctgtacaccggtgcgatcctggaagcc
aacctgttgccgccgccggagccgaaaaaagagtggcgtgcactgatggatgacctgtca
gacacctcatgcaaaatgtatcgtggttacgtgcgtgaaaatccggaattcgtgccgtac
ttccgcgccgcgacgccggaactggagctgggcaagttgccgttgggttcacgcccggcc
aaacgcaagccaaacggcggcgttgaaagcctgcgtgccattccatggatcttcgcctgg
acgcagaaccgcctgatgctgccggcctggctgggtgccggtgccggtttgcaagaggcg
gtgaaggccggtaagcaggatcaactggaagccatgtgccgcgactggccgttcttctcc
acccgcatcgcgatgctggaaatggtgttcgccaaggccgacctgtggctggcggaatac
tacgatcagcgtctggtcgacaaatcgctgtggccgctggggcagcaattgcgcgaccag
ctggcaagcgacatcaaggtggtgttgaccatcgccaatgacgcgcacctgatggaagac
ttgccgtggatcgccgaatccattgcgctgcgtaacgtgtataccgatccgctgaacgta
ctgcaggcggaactgctgcatcgttcgcgtcaacaggaacaaccggatgcccgcgttgag
caggcgctgatggtgaccattgccggcgtcgccgccgggatgcgcaacaccggctag

DBGET integrated database retrieval system