KEGG   Solanum pennellii: 107004419Help
Entry
107004419         CDS       T04130                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
spen  Solanum pennellii
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spen00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    107004419
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    107004419
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107004419
   00430 Taurine and hypotaurine metabolism
    107004419
Enzymes [BR:spen01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     107004419
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
11
AA seq 503 aa AA seqDB search
MVLSKIASETDLSVHSTFASRYVRTSLPRFKMPENSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLMMDSINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLEDGETAVG
VGTVGSSEAIMLAGLAFKRKWQNKMKAQGKPYDKPNIVTGANVQVCWEKFARYFEVELKE
VKLTDGYYVMSPEKAVEMVDENTICVAAILGSTLNGEFEDVKKLNDLLIEKNKETGWDTP
IHVDAASGGFIAPFIYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRNKEDLPDEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGYEGYKNVMENCQENARVLREGLEK
TGRFEIVSKEVGVPLVAFSLKDNSKHDEFEISETLRRFGWIVPAYTMPPDAQHITVLRVV
IREDFSRTLAERLVMDIVKVLHELDMLPARVKAKLAVAEEAAAANGIDSVAHHKTDREWE
LQVTEAWKKFVADKKKNKTMGVC
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggttctgtccaagatagcatcggaaactgacttgtccgttcactcgactttcgcatct
cgatatgttcgaacttctcttccaaggtttaagatgccagaaaattcaataccaaaggaa
gcagcctatcaaattataaatgatgaacttatgttagatggaaatccaaggttgaatttg
gcatcttttgtgacaacatggatggaaccagaatgtgacaaattgatgatggattccatt
aacaaaaattatgttgacatggatgaatatcctgtcaccactgagcttcagaatcggtgt
gtaaacatgatagcgcatttatttaatgcaccacttgaagatggagaaactgcagttgga
gttggaacagttggatcttcagaagccattatgcttgctggattggcctttaagagaaaa
tggcaaaacaaaatgaaagcccaaggaaagccctatgataagcccaacattgttactggt
gctaatgtccaggtgtgttgggaaaaatttgcaaggtattttgaagttgagctaaaagaa
gtgaagttgactgatggatactatgtgatgagccctgagaaagctgtggaaatggttgat
gagaacacaatttgtgtagctgctattttgggttcaactcttaatggagaatttgaagat
gtaaagaaattgaatgacctcttgattgagaagaacaaagaaacagggtgggacactcca
attcatgtggatgcagctagtggtggatttattgcaccatttatatatccagaacttgaa
tgggactttagattgccattggttaaaagtattaatgtgagtggacacaaatatggtctt
gtttatgctggtattggttgggtcatttggaggaacaaagaagacttgcctgatgaactt
atttttcatattaattatcttggtgctgatcaacctactttcactctcaatttctctaaa
ggatcaagtcaagtaattgctcaatattaccaacttattcgtttgggttatgagggttac
aagaatgttatggagaattgtcaagaaaatgcaagggtactaagagaaggacttgaaaag
acaggaagatttgagatagtctccaaagaagttggagttcccttggttgcattttctctt
aaagacaatagcaaacatgatgagtttgaaatttctgaaactttaaggagatttggatgg
attgttccagcatacactatgccaccagatgctcaacacatcacagttcttagagttgtt
attagagaagatttctccagaacactcgcggagcgactggttatggacatcgttaaagtc
ctccacgagctcgacatgcttccagcacgtgtcaaagctaagctcgccgtggccgaggag
gcggccgcggcgaacggtatcgacagcgtggcacatcataaaacggatagagaatgggag
ttacaggttactgaagcatggaagaagtttgttgctgataaaaagaagaataagactatg
ggagtttgttga

DBGET integrated database retrieval system