KEGG   Staphylococcus pettenkoferi: CEP67_04620Help
Entry
CEP67_04620       CDS       T04943                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
spet  Staphylococcus pettenkoferi
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spet00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    CEP67_04620
Enzymes [BR:spet01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     CEP67_04620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(965625..966230)
Genome map
AA seq 201 aa AA seqDB search
MYETYHSGWIECITGSMFSGKSEELIRRLRRGLYAKQKVIVFKPAIDDRYDKDKIVSHNG
NAIEAFNITTAAEILKYDLSDVDVIGIDEVQFFDAEIVHIAEQLADQGHRVVTAGLDMDF
RGQPFEPMPAMLAVSEIIIKLQAVCAVCGSSSSRTQRLIDGKPAKVDDPVILVGANESYE
PRCRAHHIVAPSDDEKEKEEL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgtacgaaacttatcactctggctggatagagtgtattacaggaagcatgtttagtggg
aaatctgaagagttgattcgacgattacgcagagggctttacgcgaaacagaaagtgatt
gtgtttaagcctgcgattgatgatcgttatgacaaagacaagattgtgtcccacaacggt
aatgcgatagaagcatttaatattactaccgctgccgaaattcttaaatatgatttatca
gatgtcgatgttattggtattgatgaagtacagttcttcgacgctgaaattgtacatata
gcggaacaactcgctgatcaaggtcatcgtgttgtgacagcaggactagacatggacttt
cgtggacagccgtttgaacctatgcctgcaatgcttgctgtaagtgaaattatcattaaa
cttcaagcagtatgtgcagtttgtggttcgtcctcaagccgcacgcaacggctcattgac
ggtaagccagcgaaagtagacgatcctgtaatattagtaggtgctaatgaaagttatgag
ccacggtgtcgtgcacatcatatcgttgcaccgagtgatgacgagaaagagaaggaggaa
ctttaa

DBGET integrated database retrieval system