KEGG   Streptococcus pyogenes MGAS10270 (serotype M2): MGAS10270_Spy1229Help
Entry
MGAS10270_Spy1229 CDS       T00355                                 

Gene name
ddlA
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sph  Streptococcus pyogenes MGAS10270 (serotype M2)
Pathway
sph00473  D-Alanine metabolism
sph00550  Peptidoglycan biosynthesis
sph01100  Metabolic pathways
sph01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sph00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    MGAS10270_Spy1229 (ddlA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MGAS10270_Spy1229 (ddlA)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    MGAS10270_Spy1229 (ddlA)
Enzymes [BR:sph01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     MGAS10270_Spy1229 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:sph01011]
 Precursor biosynthesis
  Amino acid ligase
   MGAS10270_Spy1229 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: ABF34294
UniProt: Q1JG50
LinkDB All DBs
Position
complement(1187184..1188230)
Genome map
AA seq 348 aa AA seqDB search
MSKQTLVLLYGGRSAEREVSVLSAESVMRAVNYDKFLVKTYFITQMGQFIKTQQFSEKPS
ESERLMTNETIELTQKIKPSDIYEEGAVVFPVLHGPMGEDGSIQGFLEVLRMPYIGTNVM
SSSIAMDKITTKRVLESIGIPQVAYTVYIDGQDLEACLVETLARLTFPIFVKPANMGSSV
GISKAQTKVELRKAIQLALTYDSRVLIEQGVVAREIEVGLLGNDKVKSTLPGEVIKDVDF
YDYQAKYVDNKITMAIPADVDQSIVTEMRSYAEVAFKALGGCGLSRCDFFLTQDGQVYLN
ELNTMPGFTQWSMYPLLWENMGLAYPDLIEVLVTLAQEMFDQRESHLI
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaacaaacgttagttctattatacggaggccgctcagcagaacgtgaagtctca
gtgctttcagcagagagtgtgatgcgagcagtcaactatgataagttcttagtaaaaact
tattttattactcagatgggccaatttatcaaaactcagcaattttcagaaaagccatcg
gaatcagaacgcttgatgacaaatgagacgatagagctaactcaaaaaataaaaccaagt
gatatctatgaagaaggtgcagttgtatttcctgtattacatggacctatgggagaagat
ggctctatccaaggtttcttagaagtgcttagaatgccatatatagggactaatgtcatg
tcttctagcatagctatggataaaattactactaaacgtgtcttagaatcaattggaatt
ccacaagttgcctatactgtttatattgacggacaagatttggaggcttgtttagttgaa
actttagcaagacttacttttcctatcttcgtaaaaccagctaatatgggttcttctgtg
gggatttccaaagcccaaacaaaagtagaattaagaaaagcgattcagttagccctgacc
tatgacagtcgtgtcttgattgaacaaggcgtggttgccagagaaattgaagttggtctc
cttggaaatgataaggttaaatcaactctcccaggagaagtaatcaaggacgttgatttt
tacgactaccaagcaaaatatgttgataataagattacgatggccattccagcagatgta
gatcagagtattgtgacagaaatgcgttcttatgctgaagtagcctttaaagccttaggt
ggttgcgggttgtcccgttgtgactttttcttgacccaagacggacaggtttaccttaac
gaattaaacaccatgccaggctttacccaatggtctatgtatccactcttatgggaaaat
atgggattggcttatccagatttgattgaagtgctggtgacactggcacaagaaatgttt
gaccagcgtgagagccatctgatttaa

DBGET integrated database retrieval system