KEGG   Sphingobium sp. EP60837: EP837_01219Help
Entry
EP837_01219       CDS       T04432                                 

Definition
(GenBank) Elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
sphb  Sphingobium sp. EP60837
Brite
Translation factors [BR:sphb03012]
 Eukaryotic Type
  Elongation factors
   EP837_01219
 Prokaryotic Type
   EP837_01219
Mitochondrial biogenesis [BR:sphb03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    EP837_01219
Exosome [BR:sphb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   EP837_01219
  Exosomal proteins of breast cancer cells
   EP837_01219
  Exosomal proteins of colorectal cancer cells
   EP837_01219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:complement(1240850..1242040)
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERNKPHCNIGTIGHVDHGKTSLTAAITKVLAETGGATFVDYANIDKAPEERERG
ITISTAHVEYETEARHYAHVDCPGHADYVKNMITGAAQMDGAILVVSATDGPMPQTREHI
LLAKQVGVPQLVVFMNKVDLVDDPEILELVELEIRELLSSYDFDGDNIPVIPGSAVKALD
GSNDEIGKQAVLKLMAAVDSFIPQPERPVDKPFLMPIEDVFSISGRGTVVTGRVETGIVK
VGEEVEIVGIRDTRKTTVTGVEMFRKLLDQGEAGDNIGALVRGVGREDVERGQVLAKPGS
VTPHTEFDAEVYVLSKEEGGRHTPFFANYRPQFYFRTTDVTGEVILPEGTEMVMPGDNVK
LGVKLIAPIAMDAGLRFAIREGGRTVGAGVVGTISK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggctaaggctaagtttgagcggaacaagccgcactgcaacatcggcaccatcggtcac
gtcgaccatggcaagacctcgctgaccgcagcgatcaccaaggtgctcgccgaaaccggc
ggcgcgaccttcgttgattacgccaacatcgacaaggctcctgaagagcgcgagcgcggc
atcaccatctcgaccgcccacgtcgaatatgagaccgaagcccgtcactatgcgcacgtc
gactgcccgggtcacgctgactacgtcaagaacatgatcaccggtgctgcccagatggac
ggcgcgatcctcgtcgtttcggccaccgacggcccgatgccccagacccgtgagcacatc
ctgctcgccaagcaggtcggcgttccccagctcgtcgtgttcatgaacaaggtcgatctg
gtcgatgatccggaaatcctcgagctggttgagctggaaatccgcgagctgctgtcgtcc
tacgacttcgacggcgacaacatccccgtcatccccggctcggccgtgaaggcgctggac
ggttccaacgacgaaatcggcaagcaggctgtcctgaagctgatggctgccgttgacagc
ttcatcccgcagccggagcgtccggttgacaagccgttcctgatgccgatcgaagacgtg
ttctcgatctcgggccgcggcaccgtcgtgaccggccgcgtcgagaccggcatcgtgaag
gttggtgaggaagtcgagatcgtcggcatccgcgacacccgcaagaccaccgtcaccggc
gtcgaaatgttccgcaagctgctcgatcagggtgaagccggcgacaatatcggtgctctg
gttcgtggcgttggccgtgaagacgttgagcgtggtcaggttctggcgaagcccggttcg
gttacgccgcacaccgagttcgacgcggaagtctatgttctgtcgaaggaagaaggcggc
cgtcataccccattcttcgcgaactatcgcccgcagttctacttccgcaccaccgacgtc
accggcgaagttatcctgccggaaggcaccgagatggtcatgcctggcgacaatgtgaag
ctcggcgtgaagctgatcgccccgatcgcgatggacgcgggtctccgcttcgccatccgt
gaaggcggccgcaccgtcggtgccggggttgtcggcacgatctcgaagtaa

DBGET integrated database retrieval system