KEGG   Sphingomonas sp. JJ-A5: BSL82_07970Help
Entry
BSL82_07970       CDS       T04967                                 

Definition
(GenBank) peptidyl-dipeptidase
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
sphj  Sphingomonas sp. JJ-A5
Brite
Enzymes [BR:sphj01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     BSL82_07970
Peptidases [BR:sphj01002]
 Metallo Peptidases
  Family M2
   BSL82_07970
Exosome [BR:sphj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BSL82_07970
CD molecules [BR:sphj04090]
 Proteins
  BSL82_07970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1525749..1527581)
Genome map
AA seq 610 aa AA seqDB search
MKARTSLLALALLLGGCAATASPPPQQAAATSGVSAADADAFVAAAEKELFDFSVFNARV
QWINNTYITEDSDAVAARVGAEGTEMSVRLAKEAARFDKTPGLSVDTRRKLGILKQGIVL
PAPSTPGAAAELNTIATRLQSTYGKGKGTLDGKPISGNDIEEKMGTVRDPAKLKEMWVSW
HKVGQPMKDDYVRMVDIANAGARELGFADTGAMWRAGYDMPADEFAGLTDRLWDQVKPLY
LQLHCYTRAKLNRKYGDAVQPATGPIRADLLGNMWAQEWGNIYDVVAPPGLGDLGYDVTD
LLVANKYDPLKMVKTGEGFFSSLGFAPLPETFWQRSQITRPRDREVVCHASAWNLDNKDD
LRIKMCTKVNGDDFVTIHHELGHNYYQRAYNQQPLLYMNGANDGFHEAIGDMIALSITPD
YLVRIGLLDEKQVPSADKDIGLLLRQAMDKVAFLPFGLLVDKWRWGVFSGEITPDNYNKA
WTDLRHQYQGIIPPVPRSEADFDPGAKFHIPGNTPYTRYFLARLLQFQFYKAACDQAGWK
GPLHRCSFYGNEQVGQRLNAMLELGASKPWPDALEAFTGAREMDGTAMIAYFRPLMTWLE
EQNKGRQCSW
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atcaaagccagaacctcccttctcgcgctggcgctgttgctcggcggctgtgccgcaacg
gcatcccctccgccgcagcaggcggcagcgacttccggggtcagtgcggccgatgccgac
gcctttgtcgcggcggccgaaaaggagctgttcgacttctcggtcttcaacgcgcgggtg
cagtggatcaacaacacctacatcaccgaagacagcgatgccgtggccgcccgcgtcggt
gcggagggcaccgaaatgtcggtccggctggcgaaggaggccgcccggttcgacaagacg
cccggcctttccgtcgacacccgccgcaagcttggcatattgaagcagggcatcgtcctg
ccagcgccgtcgactccgggcgctgcggccgaactcaacaccatcgccacccgcctccaa
tccacctatggcaagggcaagggcacgctggacggcaagccgatctcgggcaacgacatc
gaagagaagatgggcaccgtccgcgatcccgcgaagctgaaggaaatgtgggtaagctgg
cacaaggtcgggcagcccatgaaggacgattatgtccgcatggtcgatatcgccaatgcg
ggcgcgcgcgagcttggctttgccgacaccggcgcgatgtggcgggcgggctatgacatg
cccgccgacgaattcgcagggctgaccgacaggctgtgggatcaggtgaagccgctctat
ctccagctgcactgctacacgcgggcgaagctgaaccggaaatacggcgatgcggtgcag
cccgcgaccggcccgatccgcgccgatctgctgggcaatatgtgggcgcaggaatggggc
aacatctatgatgtcgtcgcgcctccgggattgggcgatctcggctatgacgtgaccgat
ctgctggtggcgaacaaatatgatccgctgaagatggtgaagaccggcgagggctttttc
tcctcgctcgggtttgcgccgctgcccgagacgttctggcagcgctcgcagatcacccgg
ccgcgcgaccgcgaggtggtttgccatgcctccgcctggaacctcgacaacaaggacgat
ctcaggatcaagatgtgcaccaaggtcaacggcgacgatttcgtcaccatccaccacgag
cttgggcacaactactatcagcgcgcctacaaccagcagcctttgctctacatgaacggc
gcgaacgacggctttcacgaggcgatcggcgacatgatcgcgctgtcgatcacgcccgat
tatctggtccggatcgggcttctggacgaaaagcaggtgccgtcggccgacaaggacatc
ggcctgctgctgcgtcaggcaatggacaaggtcgctttcctgccctttggcctgctggtc
gacaaatggcgctggggcgtgttttcgggcgagatcacgccggacaattacaacaaggcg
tggaccgacctgcgccaccagtatcagggcatcatcccgcccgtgccgcgaagcgaagcg
gatttcgatcccggcgcgaaattccacatccccggcaacacgccctacacccgctatttc
ctggcgcggctgctccagttccagttctacaaggcggcatgcgaccaggctggctggaag
gggccgctccaccgctgctccttctatggcaacgagcaggtcggccagcggctgaacgcg
atgctggagctgggcgcgtcaaagccgtggcccgatgcgctggaagccttcaccggcgcg
cgcgagatggacggcacggcgatgatcgcctatttccggccgctgatgacctggcttgag
gaacagaacaagggccgccagtgtagctggtga

DBGET integrated database retrieval system