KEGG   Sphingopyxis fribergensis: SKP52_02890Help
Entry
SKP52_02890       CDS       T03542                                 

Definition
(GenBank) glutathione S-transferase-like protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
sphk  Sphingopyxis fribergensis
Pathway
sphk00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:sphk00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SKP52_02890
Enzymes [BR:sphk01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     SKP52_02890
Transporters [BR:sphk02000]
 Other Transporters
  Pores ion channels [TC:1]
   SKP52_02890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_C_3 GST_C GST_N_2 GST_N GST_C_2 GST_N_4
Motif
Other DBs
NCBI-ProteinID: AJA07507
UniProt: A0A0A7PHT0
LinkDB All DBs
Position
590747..591397
Genome map
AA seq 216 aa AA seqDB search
MIVYGSLVSPFVRKLLGFLGEKGIEFELKGVGIGDPDPGFRAASPLGKMPAMDDDGFLLA
DSSAIIQYVEAKHPEPALIPADPQERGRVIWWEEFGDTVFAACSGKMFFNRIVAPKFLGR
EGDLAAAVQAEGEELPKLLAYLESAIPASGFLVGDRLTLADLAVASPLMNLRHCGACIDP
AVHPKISAWSEAILSRPSMAPWIAKEERLIARVLAS
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgattgtctatggctcgctggtgtcgccgttcgtccggaaattgctgggctttctgggc
gaaaaagggatcgagttcgagctgaagggcgtcgggatcggcgatcccgatccgggtttc
cgcgccgcttcgccactgggcaagatgcccgcgatggacgacgacggctttctgctcgcc
gattcgagcgccatcatccaatatgtcgaggcgaagcatcccgagccggcgctgatcccc
gccgacccgcaggaacgcggccgggtgatctggtgggaggaattcggcgatacggtgttt
gcggcgtgcagcggcaagatgttcttcaaccgcatcgtcgcgccgaaattcctggggcgc
gagggtgaccttgccgccgcggtgcaggccgagggtgaggaattgcccaagctgctcgcc
tatctggaaagcgcgatcccggcgtcggggtttctcgtcggcgaccggttgacgcttgct
gacctggcggtcgcgtcgccgttgatgaacctccgtcattgcggggcatgcatcgatccc
gctgtgcatccgaaaatttcggcgtggagcgaggccatcctgtcgcgcccgagcatggcg
ccgtggattgcgaaggaagagcggctgatcgcgcgggtgctggctagctag

DBGET integrated database retrieval system