KEGG   Sphingomonas sp. MM-1: G432_17030Help
Entry
G432_17030        CDS       T02498                                 

Definition
(GenBank) glutathione S-transferase-like protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
sphm  Sphingomonas sp. MM-1
Pathway
sphm00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:sphm00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    G432_17030
Enzymes [BR:sphm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     G432_17030
Transporters [BR:sphm02000]
 Other Transporters
  Pores ion channels [TC:1]
   G432_17030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_C_3 GST_C GST_N GST_N_2 GST_C_2
Motif
Other DBs
NCBI-ProteinID: AGH51124
UniProt: M4S9E2
LinkDB All DBs
Position
3618310..3618969
Genome map
AA seq 219 aa AA seqDB search
MIVYGSSMSPYVRKVLAFAAEKGLDFELKSLGLQADDPDFRAASPFGLMPAFRDGDFRLS
DSTAIVTYMEAIKPDPALIPAEPRARAMTIWWDEIADTKFVPCMAKMFFNRIVCPLFLKQ
EGDLAEADRAEREDLPKLLDFLEPRVPESGYLVEDRMTLADIAIVQPFANFGHVGAGVDA
ARHPRVAAYVAGIQARPSIAPWIERERAFFAKVGYEPNR
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtttatggaagttccatgtcgccttatgtgcgcaaggtattggcctttgccgcc
gagaaggggctggatttcgagctgaaatcgctgggcttgcaggcggatgacccggatttc
cgcgcggcgagccccttcgggctgatgccggcattccgcgacggggattttcgcctgtcc
gattccaccgccatcgtaacctatatggaggccatcaagcccgatccggcgctgatccct
gccgagcccagggcgcgggcgatgacgatctggtgggacgagatcgctgatacgaagttc
gtgccgtgcatggccaagatgttcttcaaccgcatcgtctgcccgctgttcctgaagcag
gagggcgacctggccgaggcggaccgggccgagcgcgaggatttgcccaagctgctggat
ttcctggagccgcgcgtgccggaatcgggatatctggtggaggaccggatgacgctggcg
gatatcgcgatcgtccagcctttcgccaatttcggccatgtgggcgcgggcgtggatgcc
gcgcgccaccccagggtggcggcctatgtggcggggatacaggcgcggccttcgatcgcg
ccgtggatcgaacgggaacgggcgttcttcgccaaggtcggttacgaaccaaataggtaa

DBGET integrated database retrieval system