KEGG   Sphingopyxis sp. 113P3: LH20_21080Help
Entry
LH20_21080        CDS       T04069                                 

Gene name
tuf
Definition
(GenBank) elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
sphp  Sphingopyxis sp. 113P3
Brite
Translation factors [BR:sphp03012]
 Eukaryotic Type
  Elongation factors
   LH20_21080 (tuf)
 Prokaryotic Type
   LH20_21080 (tuf)
Mitochondrial biogenesis [BR:sphp03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    LH20_21080 (tuf)
Exosome [BR:sphp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   LH20_21080 (tuf)
  Exosomal proteins of breast cancer cells
   LH20_21080 (tuf)
  Exosomal proteins of colorectal cancer cells
   LH20_21080 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4281500..4282690
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERTKPHCNIGTIGHVDHGKTSLTAAISKVLSEIQGGTAVDFANIDKAPEERERG
ITISTAHIEYETDARHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTKEHI
LLAKQVGVPTMVVFLNKVDQLDDPELLELVELEIREELSKRDFDGDNIPIIAGSALAALE
GRDDNIGKEAILKLMEAVDSWIPQPERPLDKPFLMPIEDVFSISGRGTVVTGRVETGVIK
VGEEVEIVGIKDTKKTVVTGVEMFRKLLDQGEAGDNIGALIRGVGREEVERGQVLAKPGS
ITPHTEFTSEVYVLSKDEGGRHTPFFANYRPQFYFRTTDVTGEVILPEGTEMVMPGDNVQ
LSVKLIAPIAMDQGLRFAIREGGRTVGAGVVASITK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggctaaggctaaatttgagcggacgaagccgcactgcaacattggtaccatcggtcac
gtcgaccacggcaagacctcgctgactgcggcgatctcgaaggtcctgtcggaaatccag
ggcggcaccgccgtcgatttcgcgaacatcgacaaggcccccgaggagcgcgagcgcggc
atcaccatctcgaccgcgcacatcgaatatgaaaccgatgcgcgccactatgcccacgtc
gactgcccgggccacgccgactatgtgaagaacatgatcaccggcgccgcccagatggac
ggtgcgatcctcgtcgtgtcggccgctgacggcccgatgccgcagaccaaggaacacatc
ctgctcgcgaagcaggttggcgttccgaccatggtcgtgttcctcaacaaggttgaccag
ctcgacgaccccgagctgctcgagctcgtcgaactcgaaatccgcgaggagctttcgaag
cgcgacttcgacggcgacaatattccgatcatcgcgggttcggctcttgccgccctcgaa
ggccgcgacgacaacatcggcaaggaagccattctgaagctgatggaagccgtcgacagc
tggatcccgcagcccgagcgtccgcttgacaagcccttcctgatgccgatcgaggacgtg
ttctcgatctcgggtcgcggcaccgtcgtcaccggccgcgtcgaaaccggcgtgatcaag
gttggtgaagaagtcgagatcgtcggcatcaaggacaccaagaagaccgtcgtcaccggc
gtcgaaatgttccgcaagctgctcgaccagggcgaagccggcgacaacatcggtgcgctg
atccgcggcgtcggccgtgaggaagtggagcgtggtcaggttctggccaagcccggctcg
atcacgccgcacaccgagttcacctcggaagtctacgtcctgtcgaaggacgagggcggc
cgtcacacgccgttctttgcgaactatcgtccgcagttctacttccgcaccacggacgtc
acgggcgaggtcatcctccccgagggcaccgaaatggtcatgccgggcgacaacgtccag
ctgtcggtcaagctgatcgctccgatcgccatggaccagggtctgcgcttcgcgattcgc
gaaggtggccgcacggtcggcgcaggggttgtcgcctcgatcacaaagtaa

DBGET integrated database retrieval system