KEGG   Streptococcus pyogenes MGAS2096 (serotype M12): MGAS2096_Spy0516Help
Entry
MGAS2096_Spy0516  CDS       T00357                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
spj  Streptococcus pyogenes MGAS2096 (serotype M12)
Pathway
spj00620  Pyruvate metabolism
spj00680  Methane metabolism
spj01100  Metabolic pathways
spj01120  Microbial metabolism in diverse environments
spj01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:spj00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MGAS2096_Spy0516 (ppc)
  Energy metabolism
   00680 Methane metabolism
    MGAS2096_Spy0516 (ppc)
Enzymes [BR:spj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     MGAS2096_Spy0516 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 Asn_synthase
Motif
Other DBs
NCBI-ProteinID: ABF35568
LinkDB All DBs
Position
489473..492286
Genome map
AA seq 937 aa AA seqDB search
MVKSGMIEETSKEGDGHLPLKKLESSNNQAIIAEEVALLKEMLENITRRMIGDDAFTVIE
SIMVLSEKQDYIELEKVVANISNQEMEVISRYFSILPLLINISEDVDLAYEINYQNNTDT
DYLGKLALTIKDLAGKDNGKDILEQVNVVPVLTAHPTQVQRKTILELTTHIHKLLRKYRD
AKAGVINLEKWRQELYRYIEMIMQTDIIREKKLQVKNEIKNVMQYYDGSLIQAVTKLTTE
YKNLAQKHGLELDNPKPITMGMWIGGDRDGNPFVTAETLCLSATVQSEVILNYYIDKLAA
LYRTFSLSSTLVQPNSEVERLASLSQDQSIYRGNEPYRRAFHYIQSRLKQTQNQLTNQPA
ARMSSSVGLNTSAWSSPASLENPILAYDSPVDFKADLKAIEQSLLDNGNSALIEGDLREV
MQAVDIFGFFLASIDMRQDSSVQEACVAELLKGANIVDDYSSLSETEKCDVLLQQLMEEP
RTLSSAAVAKSDLLEKELAIYTTARELKDKLGEEVIKQHIISHTESVSDMFELAIMLKEV
GLVDQQRARVQIVPLFETIEDLDNARDIMAAYLSHDIVKSWIATNRNYQEIMLGYSDSNK
DGGYLASGWTLYKAQNELTAIGEEHGVKITFFHGRGGTVGRGGGPSYDAITSQPFGSIKD
RIRLTEQGEIIENKYGNKDVAYYHLEMLISASINRMVTQMITDPNEIDSFREIMDSIVAD
SNTIYRKLVFDNPHFYDYFFEASPIKEVSSLNIGSRPAARKTITEITGLRAIPWVFSWSQ
NRIMFPGWYGVGSAFKRYIDRAQGNLERLQHMYQTWPFFHSLLSNVDMVLSKSNMNIAFQ
YAQLAESQDVRDVFYEILDEWQLTKNVILAIQDHDDLLEDNPSLKHSLKSRLPYFNVLNY
IQIELIKRWRNNQLDENDEKLIHTTINGIATGLRNSG
NT seq 2814 nt NT seq  +upstreamnt  +downstreamnt
ttggtaaaaagtggtatgatagaagaaactagcaaagaaggagatggtcatttgccactt
aaaaagttagagagtagtaacaatcaagctatcattgctgaagaagttgctcttttgaaa
gaaatgttggaaaatatcacacgacggatgattggagatgacgcgtttacagttatcgag
tctattatggtgttatctgaaaaacaagattacatagaattagaaaaagttgtcgccaat
atttcaaatcaagaaatggaagtgatttccaggtatttttctattttacccttgctaatc
aatatttcagaagatgtcgatttagcctatgaaattaattatcaaaataatacggatact
gattatttaggaaaattagccctaaccatcaaggatcttgctggaaaagataatggtaaa
gacattttggagcaggttaatgtggttcctgttttaacagcacatccgacgcaagtacaa
cgtaaaacgattctggaattgacaactcacattcataaacttctgcgcaaataccgtgat
gctaaggctggtgtgattaatcttgagaaatggcgtcaggagctatatcgttatattgaa
atgatcatgcagacagatattattcgcgagaaaaagcttcaggtgaaaaacgagataaaa
aatgtcatgcagtattacgatggttctctcattcaagcagtgaccaagttgacaacagag
tacaaaaacttagcccaaaaacacggtctagagttagacaatcccaaacccattaccatg
gggatgtggattggtggggaccgtgatgggaaccccttcgtcacagctgaaaccttgtgc
ttgtcagctacggttcaaagtgaggttatcctcaattactacattgacaaattagcagcc
ctttaccgaacattttcactgtcgtcaaccttggtacaacccaactcggaagtggaacgt
ttagccagtttgtctcaggaccaatcgatttaccgtggaaatgaaccttatcgcagagct
tttcattatattcaatcgcgtcttaaacaaacacaaaatcaactaactaatcagccagca
gctcgtatgagtagtagtgtgggactaaacacatctgcttggtcctcaccagctagttta
gaaaatcccatcttagcctatgactctcctgttgattttaaagctgatctaaaggctatt
gagcagtcgctacttgataatggcaactccgctttgattgagggggatttgcgagaagtc
atgcaagctgttgatatttttggcttcttcttagcaagcattgacatgaggcaagactcc
agtgtccaagaagcttgtgtggcagagttattaaaaggagccaatattgttgacgattat
agctctctttcagaaactgaaaaatgcgatgttctcttacaacaattaatggaggagcca
agaaccttatcctcggcggcagttgctaaatcagacctattagaaaaagaactggctatc
tatactacggcacgagaattgaaagataagcttggagaagaggttattaagcaacatatt
atttcacatacagaaagtgtctctgatatgtttgagttggccatcatgcttaaagaagtg
ggattggttgaccagcagcgggctcgtgtgcaaattgttcccctctttgaaaccattgag
gatttagataatgcccgtgacatcatggcagcctatttaagccatgacattgtcaaatct
tggattgcaacgaatcgtaattaccaagaaatcatgttaggttattctgacagtaataaa
gatggtggctacttggcatcgggttggactctttataaagctcagaatgaattaacggct
attggtgaggaacatggagtgaaaatcaccttcttccatggtcgtggaggaacagttggt
cgaggaggtggcccttcttatgatgccattacttcacaaccttttggttccatcaaagat
cggattcgtctgacagagcaaggggaaattattgaaaacaaatacggcaataaagatgtg
gcttattaccatttagaaatgttgatttcagcttctatcaatcgtatggtgactcaaatg
ataacagatcctaatgagattgatagttttcgagaaatcatggatagcattgttgctgat
agcaataccatttatcgaaaattggtttttgacaacccccatttctatgattatttcttt
gaggcaagcccgattaaggaagtttccagtctcaacattgggtcaagaccagcagcccgt
aaaacgattacggaaattacaggcttgcgtgccattccttgggtcttttcatggtcacaa
aatcgcatcatgttcccaggttggtatggggtaggttcagcctttaaacgttatattgac
cgagcacaaggtaaccttgaacgcctccaacacatgtatcagacgtggccttttttccat
tccttgttatcaaatgttgatatggtattatctaaatcaaacatgaatattgcctttcag
tatgcacaactagctgaaagtcaggatgttcgagatgttttttatgagattttggatgag
tggcaattgacaaaaaatgttattcttgctatccaagaccatgatgatctattggaggat
aatccttcccttaagcatagcttgaagtcacgcttgccgtattttaatgtgttgaactat
attcaaattgaattgattaaacgttggcgtaataatcaacttgacgaaaatgatgaaaaa
ttgatccatacaactatcaatggcatagcaactggtttacgtaattcaggctaa

DBGET integrated database retrieval system