KEGG   Streptococcus pyogenes MGAS2096 (serotype M12): MGAS2096_Spy1540Help
Entry
MGAS2096_Spy1540  CDS       T00357                                 

Definition
(GenBank) Aspartate aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
spj  Streptococcus pyogenes MGAS2096 (serotype M12)
Pathway
spj00220  Arginine biosynthesis
spj00250  Alanine, aspartate and glutamate metabolism
spj00290  Valine, leucine and isoleucine biosynthesis
spj01100  Metabolic pathways
spj01110  Biosynthesis of secondary metabolites
spj01130  Biosynthesis of antibiotics
spj01210  2-Oxocarboxylic acid metabolism
spj01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:spj00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MGAS2096_Spy1540
   00290 Valine, leucine and isoleucine biosynthesis
    MGAS2096_Spy1540
   00220 Arginine biosynthesis
    MGAS2096_Spy1540
Enzymes [BR:spj01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     MGAS2096_Spy1540
    2.6.1.66  valine---pyruvate transaminase
     MGAS2096_Spy1540
Amino acid related enzymes [BR:spj01007]
 Aminotransferase (transaminase)
  Class I
   MGAS2096_Spy1540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ABF36592
LinkDB All DBs
Position
complement(1484167..1485417)
Genome map
AA seq 416 aa AA seqDB search
MVYNMEYEVYETMKIIEKSSKLEHVAYDIRGPVLDEANRMIASGEKILRLNTGNPAAFGF
EAPDEVIRDLIVNARLSEGYSDSKGIFSARKAIMQYCQLKGFPDVDIEDIYLGNGVSELI
SMSLQALLDNGDEVLVPMPDYPLWTACVSLGGGKAVHYLCDEEAGWYPDIADIKSKITSR
TKAIVVINPNNPTGALYPKEILEDIVALAREHQLIIFADEIYDRLVMDSKEHIAIASLAP
DVFCVSMNGLSKSHRIAGFRVGWMVLSGPKDHVKGYIEGLNMLANMRLCSNVLAQQVVQT
SLGGHQSVDALLLPGGRIFEQRNFIYEAINAIPGLSAVKPEAGLYLFPKIDRQMYRIDDD
EEFVLQLLKQEKVMLVHGRGFNWKDPDHFRIVYLPSVEELEDVQEKITRVLYQYRR
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
ttggtttataatatggaatacgaggtgtatgagactatgaaaattattgaaaaatcatca
aaattagaacatgttgcctatgatattcgagggcctgttttggatgaagctaatcgcatg
attgcgagtggtgaaaaaattctgcgtttaaatactggcaatcctgctgcctttggtttt
gaagcaccagatgaagtgattcgtgatttaattgtcaacgcgaggctaagtgagggctat
tctgacagtaaagggattttttcagcgcgtaaggctatcatgcaatattgtcaactcaag
ggcttcccagatgttgacattgaagatatttatttgggaaatggcgtgtcagagttgata
tccatgtcccttcaagctttgctagataatggcgatgaagttttagtaccaatgccggat
tatcctttatggacggcttgtgtgagtcttggtggaggaaaagcggtccattatctttgt
gatgaagaagctggttggtatcctgatattgctgatatcaaatcaaaaatcacgagtcgc
accaaagctattgtggtcatcaatcctaataacccaacaggagctctttatcctaaggag
attttagaagacatcgttgctttggcaagagaacaccagctgattatttttgccgatgaa
atctatgatcgtttggtgatggatagtaaagagcatattgctattgcaagtttggcacct
gatgttttttgtgtatctatgaatggcctttccaaatctcatcgtattgctggttttcgt
gttggatggatggtcttatcaggtcctaaagaccatgttaaaggttacattgaagggtta
aacatgcttgccaatatgcggttatgctccaatgttttagcccaacaagttgttcaaact
tccttaggaggtcatcaatcagttgatgcactgttactgccaggagggcgtatttttgag
caacgtaattttatttatgaagctattaatgctatccctggcttatcggcagttaaacct
gaggcaggtctttatttatttccgaaaattgatcgtcagatgtatcgtattgatgatgat
gaagaatttgtcttacagttattaaagcaagaaaaagtgatgttggtacatggacgtggt
tttaactggaaagatccagatcacttccgtattgtttacctaccaagtgtagaagaatta
gaagatgtccaagaaaagattacacgtgtcttataccagtatagacgttaa

DBGET integrated database retrieval system