KEGG   Sphingomonas sp. KC8: KC8_02095Help
Entry
KC8_02095         CDS       T04987                                 

Definition
(GenBank) peptidyl-dipeptidase A
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
spkc  Sphingomonas sp. KC8
Brite
Enzymes [BR:spkc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     KC8_02095
Peptidases [BR:spkc01002]
 Metallo Peptidases
  Family M2
   KC8_02095
Exosome [BR:spkc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KC8_02095
CD molecules [BR:spkc04090]
 Proteins
  KC8_02095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-ProteinID: ARS26082
UniProt: A0A1X9YB86
LinkDB All DBs
Position
413628..415448
Genome map
AA seq 606 aa AA seqDB search
MKITIRAAVSALALAVAAVPAIAAREPALTAAQADQFIAKAEKELFDLSLPTQQVAWVNA
TYLTDDTDALNTLFGAKNTEASVRLAKEAAKYDKVSGLSPDTRRKLDILRQGIVLPAPSR
EGAATELNALSTKMSSAYGKGRGTLNGKDINGSDIEEKMGTDRNPAELKEMWASWHDNVG
KPMKDDYARMVAIANQGAKELGYQDLGAMWRSNYDMAPDDFAKLTDKLWMQVKPLYDQLH
CYTRTKLNEKYGDAVQPKSGPIRADLLGNMWAQEWGNIYDIVAPKGAGDLGFDTTDLLNA
KGYDALKMVKGGEGFFSSLGFAPLPDSFWARSQFTKPADREVICHASAWDVDNKDDLRIK
MCIKVNGDDFTTIHHELGHNYYQRAYNKQPFLYLNGANDGFHEAIGDAIALSITPDYLVQ
IGLLDPAKVPSEDKDTGLLLRQAMDKVAFLPFGLLVDKWRWGVFNGTIKPAHYNDAWTDL
RLQYQGITPPVERGADAFDAGAKYHVPASTPYARYFLARILQFQFYKAACDASGWTGPLH
RCSFYGNKEVGAKLNAMLEMGMSKPWPDALQAFTGSREMDGTAMIAYFKPLMTWLEAQNK
GKTCGW
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcacaatccgcgcggctgtttccgcgcttgcgctggctgtcgccgctgtgccg
gccatcgcggccagggaacccgcgctgacagcggcccaggccgaccagttcatcgccaag
gcggaaaaggaattgttcgacctgtcgctccccacccagcaggtggcgtgggtgaacgcg
acctacctgaccgacgataccgacgcgctgaacacgctgttcggggcgaagaataccgag
gcgtccgtcagactggccaaggaagcggcgaaatatgacaaggtttcgggcctgtcgccg
gacacgcgccgcaagctggacatattgcggcagggcatcgtcctgccggcgccctcccgc
gaaggggctgcgaccgaactgaacgcgctgtcgacgaagatgagctccgcctacggcaag
gggcgcggcacgctgaacggcaaggacatcaacggttccgacatcgaagagaagatggga
acggatcgcaatccggccgaactgaaggaaatgtgggccagctggcacgacaatgtcggc
aagccgatgaaggacgattatgcccgcatggttgcgatcgccaatcagggcgcgaaggaa
ctgggctatcaggatctcggcgcgatgtggcgctcgaactacgatatggcgccggatgat
ttcgccaagctgaccgacaaattgtggatgcaggtgaagccgctctacgatcagctgcat
tgctacacccgcaccaagctgaacgagaaatatggcgatgcggtgcagccgaaatccggc
ccgatccgtgccgatctgctgggcaatatgtgggcgcaggaatggggcaacatctatgac
atcgttgccccgaagggcgcgggcgatctgggtttcgacaccaccgacctgctcaacgcc
aagggctatgacgcgctgaagatggtcaagggcggcgaagggtttttctcgtcgctgggc
tttgcgccgctgccggacagcttttgggcgcgttcgcaattcaccaagccggccgaccgc
gaggtgatctgccacgcatccgcgtgggacgtggacaataaggacgacctgcggatcaag
atgtgcatcaaggtgaacggcgacgatttcaccaccatccaccatgaactcggccataat
tattatcagcgggcctataacaagcagccgttcctgtatctgaatggcgccaatgacggg
ttccacgaagcgatcggcgatgccatcgcgctgtcgatcacacccgattatctggtgcag
atcggcctgctcgatcccgccaaggtgccgtccgaagacaaggataccggcctcttgctg
cggcaggcgatggacaaggtggcgttcctgccgttcggcctgctcgtcgataaatggcgc
tggggggtgttcaacggcacgatcaagccggcgcattataatgatgcgtggaccgacctg
cgcctgcaatatcaggggatcaccccgccggtggaacgcggcgcggatgcgttcgatgcg
ggggccaaatatcatgtgcccgccagcacgccttatgcccgttacttcctcgcgcggatt
ttgcagttccagttctacaaggcggcgtgcgacgcttccgggtggaccgggccgctgcac
cgctgttccttttatggcaacaaggaagtcggcgcgaagctgaacgcgatgctggaaatg
ggtatgtcgaagccctggcccgatgcgttgcaggcctttaccggcagccgcgaaatggat
ggcacggcgatgattgcgtatttcaagccgctgatgacgtggctggaagcgcagaacaag
ggcaagacctgcggctggtaa

DBGET integrated database retrieval system