KEGG   Sphingomonas sp. KC8: KC8_18815Help
Entry
KC8_18815         CDS       T04987                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
spkc  Sphingomonas sp. KC8
Pathway
spkc00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:spkc00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    KC8_18815
Enzymes [BR:spkc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     KC8_18815
Transporters [BR:spkc02000]
 Other Transporters
  Pores ion channels [TC:1]
   KC8_18815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_C GST_C_3
Motif
Other DBs
NCBI-ProteinID: ARS29326
UniProt: A0A1X9YKJ5
LinkDB All DBs
Position
complement(3873220..3873837)
Genome map
AA seq 205 aa AA seqDB search
MSELIFYTNPQSRGRIVRWMLEETGASYRTEIVPYGPVMKGPDYLAINPMGKVPAIRHGA
TIVTECAAICAYLADAFPAAGLAPPTDRRGDYYRWLFFAAGPVEAAVTDKMLKVEPNAEQ
RGSVGYGSFEETIDNLERAVTGRPYFCGDQFTAADVYAGSHIAWGMMFKTIEERPAFIDY
VARIHDRPAYKRAAELDDAAAAATV
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagctgatattctacaccaacccgcaatcgcgcggccgtatcgtgcgctggatg
ctggaagaaaccggcgcgtcctatcgcaccgaaatcgtgccctacggcccggtcatgaag
gggccggactatctggcgatcaacccgatgggcaaggttcccgcaatccggcacggcgcc
accatagtcaccgaatgcgcggcgatctgcgcctatctggccgatgcctttcctgccgct
ggccttgcaccgcccacggatcggcgcggcgattattatcgctggctgttcttcgccgcc
ggcccggtcgaagcggcggtgacggacaagatgctgaaggtggaacccaatgccgaacag
cgtggatccgtcggctatggcagcttcgaagaaacaatcgacaatctggaacgcgccgtc
accggccgcccctatttctgtggcgatcagtttacggcagcggacgtctatgccggatcg
cacatcgcctggggcatgatgttcaagacgatcgaagaacgcccggcctttatcgattat
gtcgcccgcatccatgatcgcccggcctataagcgcgccgccgaactggacgatgcagcc
gccgccgctaccgtctga

DBGET integrated database retrieval system