KEGG   Shewanella pealeana: Spea_2340Help
Entry
Spea_2340         CDS       T00606                                 

Definition
(GenBank) Peptidyl-dipeptidase A
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
spl  Shewanella pealeana
Brite
Enzymes [BR:spl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     Spea_2340
Peptidases [BR:spl01002]
 Metallo Peptidases
  Family M2
   Spea_2340
Exosome [BR:spl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Spea_2340
CD molecules [BR:spl04090]
 Proteins
  Spea_2340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
2851374..2853212
Genome map
AA seq 612 aa AA seqDB search
MSKSLVKVSKLSAVIALTLGVSACSKIEAESKPVTVDKTIEAKQFIKDAESKMADLSIEI
NRSEWIYSNFITQDTAALAASVSEKYTAASVELATTSAQFANLPLSDAEKRKLNILRSSI
VLPAPLDVVKNAELANISAELNGLYGKGKYCFEDGHCLTQPELSAIMGTSTNPDELLEVW
QGWREIAKPMRPLFEREVELANEGAKDLGYADLSELWRSNYDMKPDEFSTELDRLWGQVK
PLYDSLHCYVRGELNEQYGDDVAPASGAIPAHLLGNMWAQSWGNIYEQVAPENADPGYDV
TELLAKHNFDEIKMVEQAETFFTSLGFEPLPDTFWERSLFVQPEDRDVVCHASAWDLDSR
DDIRIKMCIQKTAEDFTVIHHELGHNFYQRAYKDQPFIFKNSANDGFHEAIGDTVALSIT
PDYLKQIGLLDEVPDASKDIGLLLKQALDKVAFLPFGLMIDQWRWKVFSGEITPEQYNKA
WWELREKYQGVKAPIARSEADFDPGAKYHVPGNVPYTRYFLAHILQFQFHQSLCEIAGDN
GPVHRCSIYGNKEAGAKLNTMLEMGQSKPWPEALAAVTGTKEMDAKAVLDYFAPLQTWLD
EQNSTANRQCGW
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaagcctagttaaggtttctaaactttcggcagtgattgcgctaacacttggc
gtttcagcttgtagtaaaatagaggctgagagtaagcctgtcacagttgataaaactata
gaagctaaacagtttatcaaggatgctgaatctaaaatggccgatctctctattgagatt
aatcgctctgagtggatctatagcaattttatcacccaagatactgcggcactggcagcc
agtgtttctgaaaaatataccgctgcatcggtagagctcgcgactacatcggcgcaattt
gccaatcttccattaagtgacgctgaaaaacgtaaactcaatatacttcgtagttctatc
gtactcccagctccactcgatgtggtaaaaaatgccgaactggccaatattagtgccgag
ctaaacggtctatacggtaaaggaaaatattgtttcgaagatggtcactgcctaactcag
cctgaactgtctgccattatgggaacatcaactaatccagatgagcttttagaggtgtgg
caaggctggcgtgaaatagccaaacctatgcgtccgctttttgaaagagaagtggagctt
gcaaatgaaggggccaaagatctgggttacgcagatctctctgagctttggcgtagtaac
tacgatatgaagcctgacgagttttccactgaacttgaccgattgtgggggcaagttaaa
cctttatatgattcgctacactgctatgttcgtggtgagctaaatgagcagtatggtgat
gatgtggcaccagcatctggagctataccagcccatctactcggcaatatgtgggcacaa
agctggggcaatatttatgagcaagtcgcgccagaaaatgccgatcctggatatgatgtc
actgagctgttagccaagcataactttgatgagataaaaatggttgagcaggccgagacc
ttctttacttctcttggcttcgagccactacctgacacattctgggaacgttctttattc
gtccagcctgaggatcgcgatgtggtttgtcacgcatcggcctgggatctcgatagtcgc
gacgatatccgcataaagatgtgtattcagaagaccgccgaagactttaccgtaattcat
catgagcttgggcataacttctatcaacgcgcttataaagaccaaccgtttatctttaaa
aatagcgccaacgatggtttccacgaggcgattggcgatactgttgccttatcgattacg
ccagattacttgaagcaaattggattacttgacgaagtccctgatgcgtccaaagatatt
gggctactactcaagcaagcattagataaggtggcgtttttgccatttggtttgatgatt
gaccaatggcgctggaaggtctttagcggtgaaatcacacctgaacaatataataaagca
tggtgggaacttcgcgaaaaataccaaggtgtgaaagctcctatcgcccgcagcgaagca
gacttcgacccaggtgctaagtatcacgtgcccggtaatgtgccctacacgcgctatttc
ttagcgcatattctgcaattccaattccatcaatccctatgtgagattgctggtgataac
ggcccagttcatagatgcagtatttatggcaacaaggaagccggagcaaaactcaacacc
atgctagaaatggggcaaagcaagccttggcctgaggcgttagcggcagtaactggcact
aaagagatggatgccaaagccgtactcgattactttgcgccactgcaaacttggttagat
gagcaaaactccactgcaaatcgtcaatgtggctggtaa

DBGET integrated database retrieval system