KEGG   Streptococcus pyogenes MGAS8232 (serotype M18): spyM18_0678Help
Entry
spyM18_0678       CDS       T00079                                 

Gene name
tufA
Definition
(GenBank) putative translation elongation factor EF-Tu
  KO
K02358  elongation factor Tu
Organism
spm  Streptococcus pyogenes MGAS8232 (serotype M18)
Brite
Translation factors [BR:spm03012]
 Eukaryotic Type
  Elongation factors
   spyM18_0678 (tufA)
 Prokaryotic Type
   spyM18_0678 (tufA)
Mitochondrial biogenesis [BR:spm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    spyM18_0678 (tufA)
Exosome [BR:spm04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   spyM18_0678 (tufA)
  Exosomal proteins of breast cancer cells
   spyM18_0678 (tufA)
  Exosomal proteins of colorectal cancer cells
   spyM18_0678 (tufA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AAL97354
UniProt: Q8P1W4
LinkDB All DBs
Position
540674..541870
Genome map
AA seq 398 aa AA seqDB search
MAKEKYDRSKPHVNIGTIGHVDHGKTTLTAAITTVLARRLPTSVNQPKDYASIDAAPEER
ERGITINTAHVEYETETRHYAHIDAPGHADYVKNMITGAAQMDGAILVVASTDGPMPQTR
EHILLSRQVGVKHLIVFMNKVDLVDDEELLELVEMEIRDLLSEYDFPGDDLPVIQGSALK
ALEGDSKYEDIIMELMSTVDEYIPEPERDTDKPLLLPVEDVFSITGRGTVASGRIDRGTV
RVNDEIEIVGIKEETKKAVVTGVEMFRKQLDEGLAGDNVGILLRGVQRDEIERGQVIAKP
GSINPHTKFKGEVYILSKDEGGRHTPFFNNYRPQFYFRTTDVTGSIELPAGTEMVMPGDN
VTINVELIHPIAVEQGTTFSIREGGRTVGSGIVSEIEA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaaaatacgatcgtagtaaaccccacgttaacattggtacaattgggcac
gttgaccatggtaaaacaactttaacagctgcaattacaacagtacttgcccgtcgttta
ccaacttcagttaaccaaccaaaagattatgcttctatcgatgctgctccagaagagcgc
gaacgcggaatcacaatcaacactgcacacgttgagtatgaaactgaaactcgtcactat
gctcacatcgacgcaccaggacacgcggactatgttaaaaacatgatcactggtgctgcc
caaatggacggagctatccttgtagttgcttcaactgatggaccaatgccacaaacgcgt
gagcacatccttctttcacgtcaagttggtgttaaacaccttatcgtcttcatgaacaaa
gttgaccttgttgatgacgaagagttgctcgaattagttgagatggaaattcgtgacctt
ctttcagaatacgatttcccaggtgatgaccttccagttattcaaggttcagctcttaaa
gctcttgaaggtgactcaaaatacgaagatatcatcatggagttgatgagtactgttgat
gagtacattccagaaccagaacgcgacactgacaaaccattacttcttccagtcgaagat
gtattctcaatcacaggtcgtggtacagttgcttcaggacgtatcgaccgtggtactgtt
cgtgttaacgacgaaatcgaaatcgttggtatcaaagaagaaactaaaaaagctgttgtt
actggtgttgaaatgttccgtaaacaacttgacgaaggtcttgcaggagacaacgtaggt
atccttcttcgtggtgttcaacgtgacgaaatcgaacgtggtcaagttattgctaaacca
ggttcaatcaacccacacactaaattcaaaggtgaagtatatatcctttctaaagacgaa
ggtggacgtcacactccattcttcaacaactaccgtccacaattctacttccgtacaact
gacgtaacaggttcaatcgaacttccagcaggtacagaaatggttatgcctggtgataac
gtaacaatcaacgttgagttgatccacccaatcgccgtagaacaaggtactactttctca
attcgtgaaggtggacgtactgttggttcaggtatcgtttcagaaatcgaagcttaa

DBGET integrated database retrieval system