KEGG   Streptococcus pneumoniae SPN034183: SPN034183_14850Help
Entry
SPN034183_14850   CDS       T02629                                 

Gene name
nanA
Definition
(GenBank) sialidase A (neuraminidase A)
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
spnu  Streptococcus pneumoniae SPN034183
Pathway
spnu00511  Other glycan degradation
spnu00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:spnu00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    SPN034183_14850 (nanA)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SPN034183_14850 (nanA)
Enzymes [BR:spnu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     SPN034183_14850 (nanA)
Bacterial toxins [BR:spnu02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   SPN034183_14850 (nanA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sialidase BNR_2 Laminin_G_3 YSIRK_signal BNR_3 BNR Gram_pos_anchor Sortilin-Vps10
Motif
Other DBs
NCBI-ProteinID: CCP33195
LinkDB All DBs
Structure
PDB: 

Jmol
Position
complement(1512133..1515195)
Genome map
AA seq 1020 aa AA seqDB search
MNRSVQERKCRYSIRKLSVGAVSMIVGAVVFGTSPVLAQEGASEQPLANETQLSGESSTL
TDTEKSQPSSETELSGNKQEQERKDKQEEKIPRDYYARDLENVETVIEKEDVETNASNGQ
RVDLSSELDKLKKLENATVHMEFKPDAKAPAFYNLFSVSSATKKDEYFTMAVYNNTATLE
GRGSDGKQFYNNYNDAPLKVKPGQWNSVTFTVEKPTAELPKGRVRLYVNGVLSRTSLRSG
NFIKDMPDVTHVQIGATKRANNTVWGSNLQIRNLTVYNRALTPEEVQKRSQLFKRSDLEK
KLPEGAALTEKTDIFESGRNGKPNKDGIKSYRIPALLKTDKGTLIAGADERRLHSSDWGD
IGMVIRRSEDNGKTWGDRVTITNLRDNPKASDPSIGSPVNIDMVLVQDPETKRIFSIYDM
FPEGKGIFGMSSQKEEAYKKIDGKTYQILYREGEKGAYTIRENGTVYTPDGKATDYRVVV
DPVKPAYSDKGDLYKGNQLLGNIYFTTNKTSPFRIAKDSYLWMSYSDDDGKTWSAPQDIT
PMVKADWMKFLGVGPGTGIVLRNGPHKGRILIPVYTTNNVSHLNGSQSSRIIYSDDHGKT
WHAGEAVNDNRQVDGQKIHSSTMNNRRAQNTESTVVQLNNGDVKLFMRGLTGDLQVATSK
DGGVTWEKDIKRYPQVKDVYVQMSAIHTMHEGKEYIILSNAGGPKRENGMVHLARVEENG
ELTWLKHNPIQKGEFAYNSLQELGNGEYGILYEHTEKGQNAYTLSFRKFNWDFLSKDLIS
PTEAKVKRTREMGKGVIGLEFDSEVLVNKAPTLQLANGKTARFMTQYDTKTLLFTVDSED
MGQKVTGLAEGAIESMHNLPVSVAGTKLSNGMNGSEAAVHEVPEYTGPLGTSGEEPAPTV
EKPEYTGPLGTSGEEPAPTVEKPEYTGPLGTAGEEAAPTVEKPEFTGGVNGTEPAVHEIA
EYKGSDSLVTLTTKEDYTYKAPLAQQALPETGNKESDLLASLGLTAFFLGLFTLGKKREQ
NT seq 3063 nt NT seq  +upstreamnt  +downstreamnt
atgaatcggagtgttcaagaacgtaagtgtcgttatagcattaggaaactatcggtagga
gcggtttctatgattgtaggagcagtggtatttggaacgtctcctgttttagctcaagaa
ggggcaagtgagcaacctctggcaaatgaaactcaactttcgggggagagctcaacccta
actgatacagaaaagagccagccttcttcagagactgaactttctggcaataagcaagaa
caagaaaggaaagataagcaagaagaaaaaattccaagagattactatgcacgagatttg
gaaaatgtcgaaacagtgatagaaaaagaagatgttgaaaccaatgcttcaaatggtcag
agagttgatttatcaagtgaactagataaactaaagaaacttgaaaacgcaacagttcac
atggagtttaagccagatgccaaggccccagcattctataatctcttttctgtgtcaagt
gctactaaaaaagatgagtacttcactatggcagtttacaataatactgctactctagag
gggcgtggttcggatgggaaacagttttacaataattacaacgatgcacccttaaaagtt
aaaccaggtcagtggaattctgtgactttcacagttgaaaaaccgacagcagaactacct
aaaggccgagtgcgcctctacgtaaacggggtattatctcgaacaagtctgagatctggc
aatttcattaaagatatgccagatgtaacgcatgtgcaaatcggagcaaccaagcgtgcc
aacaatacggtttgggggtcaaatctacagattcggaatctcactgtgtataatcgtgct
ttaacaccagaagaggtacaaaaacgtagtcaactttttaaacgctcagatttagaaaaa
aaactacctgaaggagcggctttaacagagaaaacggacatattcgaaagcgggcgtaac
ggtaaaccaaataaagatggaatcaagagttatcgtattccagcacttctcaagacagat
aaaggaactttgatcgcaggtgcagatgaacgccgtctccattcgagtgactggggtgat
atcggtatggtcatcagacgtagtgaagataatggtaaaacttggggtgaccgagtaacc
attaccaacttacgtgacaatccaaaagcttctgacccatcgatcggttcaccagtgaat
atcgatatggtgttggttcaagatcctgaaaccaaacgaatcttttctatctatgacatg
ttcccagaagggaagggaatctttggaatgtcttcacaaaaagaagaagcctacaaaaaa
atcgatggaaaaacctatcaaatcctctatcgtgaaggagaaaagggagcttataccatt
cgagaaaatggtactgtctatacaccagatggtaaggcgacagactatcgcgttgttgta
gatcctgttaaaccagcctatagcgacaagggggatctatacaagggtaaccaattacta
ggcaatatctacttcacaacaaacaaaacttctccatttagaattgccaaggatagctat
ctatggatgtcctacagtgatgacgacgggaagacatggtcagcgcctcaagatattact
ccgatggtcaaagccgattggatgaaattcttgggtgtaggtcctggaacaggaattgta
cttcggaatgggcctcacaagggacggattttgataccggtttatacgactaataatgta
tctcacttaaatggctcgcaatcttctcgtatcatctattcagatgatcatggaaaaact
tggcatgctggagaagcggtcaacgataaccgtcaggtagacggtcaaaagatccactct
tctacgatgaacaatagacgtgcgcaaaatacagaatcaacggtggtacaactaaacaat
ggagatgttaaactctttatgcgtggtttgactggagatcttcaggttgctacaagtaaa
gacggaggagtgacttgggagaaggatatcaaacgttatccacaggttaaagatgtctat
gttcaaatgtctgctatccatacgatgcacgaaggaaaagaatacatcatcctcagtaat
gcaggtggaccgaaacgtgaaaatgggatggtccacttggcacgtgtcgaagaaaatggt
gagttgacttggctcaaacacaatccaattcaaaaaggagagtttgcctataattcgctc
caagaattaggaaatggggagtatggcatcttgtatgaacatactgaaaaaggacaaaat
gcctataccctatcatttagaaaatttaattgggactttttgagcaaagatctgatttct
cctaccgaagcgaaagtgaagcgaactagagagatgggcaaaggagttattggcttggag
ttcgactcagaagtattggtcaacaaggctccaacccttcaattggcaaatggtaaaaca
gcacgcttcatgacccagtatgatacaaaaaccctcctatttacagtggattcagaggat
atgggtcaaaaagttacaggtttggcagaaggtgcaattgaaagtatgcataatttacca
gtctctgtggcgggcactaagctttcgaatggaatgaacggaagtgaagctgctgttcat
gaagtgccagaatacacaggcccattagggacatccggcgaagagccagctccaacagtc
gagaagccagaatacacaggcccactagggacatccggcgaagagccagccccgacagtc
gagaagccagaatacacaggcccactagggacagctggtgaagaagcagctccaacagtc
gagaagccagaatttacagggggagttaatggtacagagccagctgttcatgaaatcgca
gagtataagggatctgattcgcttgtaactcttactacaaaagaagattatacttacaaa
gctcctcttgctcagcaggcacttcctgaaacaggaaacaaggagagtgacctcctagct
tcactaggactaacagctttcttccttggtctgtttacgctagggaaaaagagagaacaa
taa

DBGET integrated database retrieval system