KEGG   Schizosaccharomyces pombe (fission yeast): SPBC428.08cHelp
Entry
SPBC428.08c       CDS       T00076                                 

Gene name
clr4
Definition
(RefSeq) histone H3 methyltransferase Clr4
  KO
K11419  histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:spo00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    SPBC428.08c (clr4)
Enzymes [BR:spo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     SPBC428.08c (clr4)
Chromosome and associated proteins [BR:spo03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     SPBC428.08c (clr4)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    SPBC428.08c (clr4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pre-SET SET Chromo
Motif
Other DBs
NCBI-GeneID: 2540825
NCBI-ProteinID: NP_595186
PomBase: SPBC428.08c
UniProt: O60016
LinkDB All DBs
Structure
PDB: 

Jmol
Position
II:complement(456575..458047)
Genome map
AA seq 490 aa AA seqDB search
MSPKQEEYEVERIVDEKLDRNGAVKLYRIRWLNYSSRSDTWEPPENLSGCSAVLAEWKRR
KRRLKGSNSDSDSPHHASNPHPNSRQKHQHQTSKSVPRSQRFSRELNVKKENKKVFSSQT
TKRQSRKQSTALTTNDTSIILDDSLHTNSKKLGKTRNEVKEESQKRELVSNSIKEATSPK
TSSILTKPRNPSKLDSYTHLSFYEKRELFRKKLREIEGPEVTLVNEVDDEPCPSLDFQFI
SQYRLTQGVIPPDPNFQSGCNCSSLGGCDLNNPSRCECLDDLDEPTHFAYDAQGRVRADT
GAVIYECNSFCSCSMECPNRVVQRGRTLPLEIFKTKEKGWGVRSLRFAPAGTFITCYLGE
VITSAEAAKRDKNYDDDGITYLFDLDMFDDASEYTVDAQNYGDVSRFFNHSCSPNIAIYS
AVRNHGFRTIYDLAFFAIKDIQPLEELTFDYAGAKDFSPVQSQKSQQNRISKLRRQCKCG
SANCRGWLFG
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcctaaacaagaggagtatgaagttgaaaggattgtggacgaaaaattggatcgt
aatggagctgtcaaactatatcgcattcgatggttgaactattcatctagaagtgatact
tgggagccccctgagaacctttctggatgttctgccgttttagcagaatggaaaaggcgg
aagaggagactaaagggaagtaactccgactcggattcaccgcaccatgcgagcaatcca
catccaaacagtagacaaaagcaccaacatcaaacttcaaagtcagtgcctcgttctcaa
agattttcgcgggaattgaatgtaaaaaaggaaaataaaaaggttttttcttctcaaact
accaagagacaatctcgaaaacaatccaccgctctgacgacgaatgatactagtatcatt
ttagacgatagtcttcatacaaattcaaagaagctggggaagacgagaaatgaagtgaag
gaggaatctcaaaaaagagaactagtttccaattctattaaagaagctacatcccccaaa
acatcttcaattctcacaaaaccgcgaaacccttccaaacttgactcttatacccatcta
agtttttacgaaaagagagagctatttcgtaagaaactgcgggaaattgaaggacccgaa
gtaacgcttgtcaatgaagttgacgatgaaccctgtccatctttagattttcaattcatt
agccagtaccgcttaacacaaggtgttatcccgcctgatccaaattttcaatctggatgc
aattgctcgtcccttggcggttgtgaccttaacaatccttctcgttgtgagtgtttagat
gatttggatgagccaactcattttgcctatgatgcacaggggcgggtccgtgcagatacg
ggtgccgttatatatgaatgcaactctttttgttcttgttcaatggagtgtcctaatcgc
gttgttcaacgtggtagaactcttccgcttgaaatatttaaaacaaaagaaaaaggatgg
ggtgtacgttcgcttcgatttgcccctgctggcacgtttatcacttgctatttaggagaa
gtcataacttcagcagaggccgccaagcgtgacaaaaattatgacgacgacggtattacc
tatttatttgatttagacatgtttgatgatgctagcgagtatacagtggatgctcagaac
tatggagatgtctctcgtttttttaaccactcctgttcacctaatatagctatttattct
gctgttcggaaccatggatttcgaaccatttatgatctcgctttttttgccatcaaagac
attcagcctctagaggagcttacatttgattacgctggtgcaaaagatttctcacctgtt
caatctcaaaaatctcagcaaaatagaatttcaaaacttcgccggcagtgcaaatgtggt
tccgctaattgtcgtggctggcttttcggttaa

DBGET integrated database retrieval system