KEGG   Streptococcus pneumoniae R6 (avirulent): spr1536Help
Entry
spr1536           CDS       T00060                                 

Gene name
nanA
Definition
(RefSeq) neuraminidase A
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
spr  Streptococcus pneumoniae R6 (avirulent)
Pathway
spr00511  Other glycan degradation
spr00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:spr00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    spr1536 (nanA)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    spr1536 (nanA)
Enzymes [BR:spr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     spr1536 (nanA)
Bacterial toxins [BR:spr02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   spr1536 (nanA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sialidase BNR_2 Laminin_G_3 YSIRK_signal BNR_3 BNR Gram_pos_anchor Sortilin-Vps10
Motif
Other DBs
NCBI-GeneID: 933902
NCBI-ProteinID: NP_359129
UniProt: P62576
LinkDB All DBs
Structure
PDB: 

Jmol
Position
complement(1514944..1518051)
Genome map
AA seq 1035 aa AA seqDB search
MSYFRNRDIDIERNSMNRSVQERKCRYSIRKLSVGAVSMIVGAVVFGTSPVLAQEGASEQ
PLANETQLSGESSTLTDTEKSQPSSETELSGNKQEQERKDKQEEKIPRDYYARDLENVET
VIEKEDVETNASNGQRVDLSSELDKLKKLENATVHMEFKPDAKAPAFYNLFSVSSATKKD
EYFTMAVYNNTATLEGRGSDGKQFYNNYNDAPLKVKPGQWNSVTFTVEKPTAELPKGRVR
LYVNGVLSRTSLRSGNFIKDMPDVTHVQIGATKRANNTVWGSNLQIRNLTVYNRALTPEE
VQKRSQLFKRSDLEKKLPEGAALTEKTDIFESGRNGKPNKDGIKSYRIPALLKTDKGTLI
AGADERRLHSSDWGDIGMVIRRSEDNGKTWGDRVTITNLRDNPKASDPSIGSPVNIDMVL
VQDPETKRIFSIYDMFPEGKGIFGMSSQKEEAYKKIDGKTYQILYREGEKGAYTIRENGT
VYTPDGKATDYRVVVDPVKPAYSDKGDLYKGNQLLGNIYFTTNKTSPFRIAKDSYLWMSY
SDDDGKTWSAPQDITPMVKADWMKFLGVGPGTGIVLRNGPHKGRILIPVYTTNNVSHLNG
SQSSRIIYSDDHGKTWHAGEAVNDNRQVDGQKIHSSTMNNRRAQNTESTVVQLNNGDVKL
FMRGLTGDLQVATSKDGGVTWEKDIKRYPQVKDVYVQMSAIHTMHEGKEYIILSNAGGPK
RENGMVHLARVEENGELTWLKHNPIQKGEFAYNSLQELGNGEYGILYEHTEKGQNAYTLS
FRKFNWDFLSKDLISPTEAKVKRTREMGKGVIGLEFDSEVLVNKAPTLQLANGKTARFMT
QYDTKTLLFTVDSEDMGQKVTGLAEGAIESMHNLPVSVAGTKLSNGMNGSEAAVHEVPEY
TGPLGTSGEEPAPTVEKPEYTGPLGTSGEEPAPTVEKPEYTGPLGTAGEEAAPTVEKPEF
TGGVNGTEPAVHEIAEYKGSDSLVTLTTKEDYTYKAPLAQQALPETGNKESDLLASLGLT
AFFLGLFTLGKKREQ
NT seq 3108 nt NT seq  +upstreamnt  +downstreamnt
atgtcttatttcagaaatcgggatatagatatagagaggaacagtatgaatcggagtgtt
caagaacgtaagtgtcgttatagcattaggaaactatcggtaggagcggtttctatgatt
gtaggagcagtggtatttggaacgtctcctgttttagctcaagaaggggcaagtgagcaa
cctctggcaaatgaaactcaactttcgggggagagctcaaccctaactgatacagaaaag
agccagccttcttcagagactgaactttctggcaataagcaagaacaagaaaggaaagat
aagcaagaagaaaaaattccaagagattactatgcacgagatttggaaaatgtcgaaaca
gtgatagaaaaagaagatgttgaaaccaatgcttcaaatggtcagagagttgatttatca
agtgaactagataaactaaagaaacttgaaaacgcaacagttcacatggagtttaagcca
gatgccaaggccccagcattctataatctcttttctgtgtcaagtgctactaaaaaagat
gagtacttcactatggcagtttacaataatactgctactctagaggggcgtggttcggat
gggaaacagttttacaataattacaacgatgcacccttaaaagttaaaccaggtcagtgg
aattctgtgactttcacagttgaaaaaccgacagcagaactacctaaaggccgagtgcgc
ctctacgtaaacggggtattatctcgaacaagtctgagatctggcaatttcattaaagat
atgccagatgtaacgcatgtgcaaatcggagcaaccaagcgtgccaacaatacggtttgg
gggtcaaatctacagattcggaatctcactgtgtataatcgtgctttaacaccagaagag
gtacaaaaacgtagtcaactttttaaacgctcagatttagaaaaaaaactacctgaagga
gcggctttaacagagaaaacggacatattcgaaagcgggcgtaacggtaaaccaaataaa
gatggaatcaagagttatcgtattccagcacttctcaagacagataaaggaactttgatc
gcaggtgcagatgaacgccgtctccattcgagtgactggggtgatatcggtatggtcatc
agacgtagtgaagataatggtaaaacttggggtgaccgagtaaccattaccaacttacgt
gacaatccaaaagcttctgacccatcgatcggttcaccagtgaatatcgatatggtgttg
gttcaagatcctgaaaccaaacgaatcttttctatctatgacatgttcccagaagggaag
ggaatctttggaatgtcttcacaaaaagaagaagcctacaaaaaaatcgatggaaaaacc
tatcaaatcctctatcgtgaaggagaaaagggagcttataccattcgagaaaatggtact
gtctatacaccagatggtaaggcgacagactatcgcgttgttgtagatcctgttaaacca
gcctatagcgacaagggggatctatacaagggtaaccaattactaggcaatatctacttc
acaacaaacaaaacttctccatttagaattgccaaggatagctatctatggatgtcctac
agtgatgacgacgggaagacatggtcagcgcctcaagatattactccgatggtcaaagcc
gattggatgaaattcttgggtgtaggtcctggaacaggaattgtacttcggaatgggcct
cacaagggacggattttgataccggtttatacgactaataatgtatctcacttaaatggc
tcgcaatcttctcgtatcatctattcagatgatcatggaaaaacttggcatgctggagaa
gcggtcaacgataaccgtcaggtagacggtcaaaagatccactcttctacgatgaacaat
agacgtgcgcaaaatacagaatcaacggtggtacaactaaacaatggagatgttaaactc
tttatgcgtggtttgactggagatcttcaggttgctacaagtaaagacggaggagtgact
tgggagaaggatatcaaacgttatccacaggttaaagatgtctatgttcaaatgtctgct
atccatacgatgcacgaaggaaaagaatacatcatcctcagtaatgcaggtggaccgaaa
cgtgaaaatgggatggtccacttggcacgtgtcgaagaaaatggtgagttgacttggctc
aaacacaatccaattcaaaaaggagagtttgcctataattcgctccaagaattaggaaat
ggggagtatggcatcttgtatgaacatactgaaaaaggacaaaatgcctataccctatca
tttagaaaatttaattgggactttttgagcaaagatctgatttctcctaccgaagcgaaa
gtgaagcgaactagagagatgggcaaaggagttattggcttggagttcgactcagaagta
ttggtcaacaaggctccaacccttcaattggcaaatggtaaaacagcacgcttcatgacc
cagtatgatacaaaaaccctcctatttacagtggattcagaggatatgggtcaaaaagtt
acaggtttggcagaaggtgcaattgaaagtatgcataatttaccagtctctgtggcgggc
actaagctttcgaatggaatgaacggaagtgaagctgctgttcatgaagtgccagaatac
acaggcccattagggacatccggcgaagagccagctccaacagtcgagaagccagaatac
acaggcccactagggacatccggcgaagagccagccccgacagtcgagaagccagaatac
acaggcccactagggacagctggtgaagaagcagctccaacagtcgagaagccagaattt
acagggggagttaatggtacagagccagctgttcatgaaatcgcagagtataagggatct
gattcgcttgtaactcttactacaaaagaagattatacttacaaagctcctcttgctcag
caggcacttcctgaaacaggaaacaaggagagtgacctcctagcttcactaggactaaca
gctttcttccttggtctgtttacgctagggaaaaagagagaacaataa

DBGET integrated database retrieval system