KEGG   Streptomyces pristinaespiralis: SPRI_6612Help
Entry
SPRI_6612         CDS       T04073                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
spri  Streptomyces pristinaespiralis
Pathway
spri00020  Citrate cycle (TCA cycle)
spri00480  Glutathione metabolism
spri01100  Metabolic pathways
spri01110  Biosynthesis of secondary metabolites
spri01120  Microbial metabolism in diverse environments
spri01130  Biosynthesis of antibiotics
spri01200  Carbon metabolism
spri01210  2-Oxocarboxylic acid metabolism
spri01230  Biosynthesis of amino acids
Module
spri_M00009  Citrate cycle (TCA cycle, Krebs cycle)
spri_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:spri00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SPRI_6612
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SPRI_6612
Enzymes [BR:spri01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     SPRI_6612
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: ALC24918
UniProt: A0A0M5J2R1
LinkDB All DBs
Position
7625727..7627946
Genome map
AA seq 739 aa AA seqDB search
MTDSTIIYTHTDEAPALATYSFLPVIQAYASTAGVTVETRDISLSGRIISQFPEYLAEGQ
RIDDALAELGALAKTPEANIIKLPNISASIPQLKAAVAELQEQGYALPDYPDDPKTDEER
DIRARYDKVKGSAVNPVLREGNSDRRAPASVKNYAKAHPHRMGAWTPESKTNVATMSADD
FRSTEKSAVIGDAGSLRIELKGDDGSTTVLRESVPVLPGEVVDASVMRVAALREFLTEQV
ARAKAEGVLFSVHLKATMMKVSDPIIFGHVVRAFFPKTFAQYGESLAKAGLTPNDGLGGI
YKGLESLADGAEIKASFDAELNEGPALAMVDSDRGITNLHVPSDVIVDASMPAMIRTSGH
MWGPDGQEADTVAVLPDSSYAGVYQVVIDDCRANGAFDPSTMGSVPNVGLMAQKAEEYGS
HDKTFEIPVTGTVRVVDAAGNAVLEQAVSAGDIFRMCQTKDAPIKDWVKLAVTRARATGV
PAVFWLDENRAHDARLIEKVRTYLAEHDTEGLQIEIMSPVKATAFSLERIRRGEDTISVT
GNVLRDYLTDLFPILELGTSAKMLSVVPLMNGGGLFETGAGGSAPKHVQQLVKENYLRWD
SLGEFLALAVSFEHLATTTGNARAKVLADTLDRATGTFLNEDKSPSRKLGGIDNRGSHFY
LALYWAQELARQTEDTQLAEAFAGLAKTLGEQERTIVDELIAVQGSPADIGGYYRPDEEK
AAAVMRPSKTFNQALAILG
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
gtgactgactcgaccatcatttatacgcacactgacgaggcgcccgccctggcgacgtac
tcgttcctgcctgtgatccaggcgtacgcctcgacggccggtgtcaccgtggagacccgt
gacatctcgctctcgggacggatcatctcgcagttccccgagtacctcgcggagggacag
cgcatcgacgacgccctcgccgagctcggggccctcgccaagacgcccgaggcgaacatc
atcaagctgcccaacatctcggcctcgatcccgcagctgaaggctgccgtcgccgagctg
caggagcagggctacgcgctgccggactacccggacgaccctaagaccgacgaggagcgc
gacatccgcgcccgttacgacaaggtcaagggcagcgccgtcaacccggtcctgcgtgag
ggcaactccgaccgccgcgccccggcgtcggtgaagaactacgccaaggcgcacccgcac
cgcatgggcgcgtggacccccgagtcgaagacgaacgtcgccacgatgtccgccgacgac
ttccgctccaccgagaagtccgcggtgatcggcgacgccggttcgctgcgcatcgagctc
aagggcgacgacggctccaccaccgtgctgcgcgagtcggtgcccgtcctccccggcgag
gtcgtcgacgcctccgtgatgcgcgtcgccgccctgcgcgagttcctcaccgagcaggtc
gcccgcgccaaggcggagggtgtgctgttctccgtgcacctgaaggccacgatgatgaag
gtctccgacccgatcatcttcggccacgtggtgcgcgccttcttcccgaagaccttcgcg
cagtacggcgagtccctcgccaaggccggcctcaccccgaacgacggcctcggcggcatc
tacaagggcctcgagtcgctcgccgacggcgccgagatcaaggcgtccttcgacgccgag
ctgaacgagggcccggccctcgccatggtcgactccgaccgcggcatcaccaacctgcac
gtaccgagcgacgtcatcgtcgacgcctccatgccggcgatgatccgcacctccggacac
atgtggggcccggacggccaggaggcggacaccgtcgccgtcctgccggacagcagctac
gcgggtgtctaccaggtcgtcatcgacgactgccgtgccaacggcgcgttcgacccgtcc
accatgggctcggtcccgaacgtcggcctgatggcgcagaaggccgaggagtacggcagc
cacgacaagacgttcgagatcccggtcaccggcaccgtgcgggtcgtcgacgccgcgggc
aacgccgtgctggagcaggccgtcagcgccggcgacatcttccgcatgtgccagaccaag
gacgcgcccatcaaggactgggtgaagctcgccgtcacccgcgcccgcgcgaccggcgtc
ccggccgtgttctggctcgacgagaaccgcgcgcacgacgcccggctgatcgagaaggtc
cggacgtacctggccgagcacgacaccgagggcctccagatcgagatcatgtcgccggtg
aaggcgaccgccttctccctggagcgcatccgccgcggcgaggacaccatctccgtcacc
ggcaacgtgctgcgcgactacctgaccgacctgttcccgatcctggagctcggcaccagc
gccaagatgctctcggtcgtcccgctgatgaacggcggcggactgttcgagacgggcgcc
ggcggctccgccccgaagcacgtccagcagctcgtcaaggagaactacctgcgctgggac
agcctcggcgagttcctcgcgctggccgtcagcttcgagcacctcgcgacgaccacgggc
aacgcccgtgccaaggtcctcgccgacacgctcgaccgcgccaccggcacgttcctcaac
gaggacaagtcgccgagccgcaagctcggtggcatcgacaaccgcggcagccacttctac
ctggccctctactgggcccaggagctggcccggcagaccgaggacacgcagctcgcggag
gctttcgcgggtctggccaagacgctcggcgagcaggagcggaccatcgtcgacgagctg
atcgctgtgcagggctcgccggccgacatcggcggttactaccgtcccgacgaggagaag
gccgcggccgtcatgcgtccgtcgaagaccttcaaccaggctctggccatcctgggctga

DBGET integrated database retrieval system