KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150: SPA3898Help
Entry
SPA3898           CDS       T00219                                 

Gene name
sodA
Definition
(GenBank) manganese superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
spt  Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150
Brite
Enzymes [BR:spt01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SPA3898 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4044575..4045195
Genome map
AA seq 206 aa AA seqDB search
MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALENLPEFADLPVEELITK
LDQVPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKA
AATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPILGLDVWEHAYYLKFQN
RRPDYIKEFWNVVNWDEAAARFAAKK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgagttatacactgccatccctgccgtacgcttatgatgcactggaaccgcacttcgat
aagcagacgatggagattcaccacaccaaacaccatcaaacctatgtcaacaacgctaac
gcggcgctggaaaacctgcctgagtttgctgacctgccggttgaagaactgattactaaa
ctggaccaggtgccagcggacaaaaaaactgtgctgcgtaacaacgcgggcggccatgct
aaccacagcctgttctggaaagggctgaaaaaaggcaccactctgcagggcgatctgaaa
gcggctatcgagcgtgacttcggttccgttgacaacttcaaagctgaattcgaaaaagca
gcagcaacccgtttcggctccggctgggcgtggctggtgctgaaaggtgacaaactggct
gtggtttctaccgcaaaccaggattccccgctgatgggtgaagccatttccggcgcttcc
ggcttcccgatcctgggtctggacgtatgggaacacgcttactatctgaaattccagaac
cgccgcccggactacatcaaagagttctggaacgtggtgaactgggacgaagcagcagcg
cgtttcgccgctaaaaaataa

DBGET integrated database retrieval system