KEGG   Strongylocentrotus purpuratus (purple sea urchin): 578079Help
Entry
578079            CDS       T01019                                 

Definition
(RefSeq) microtubule-associated protein futsch
  KO
K11423  
histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    578079
Enzymes [BR:spu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     578079
Chromosome [BR:spu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     578079
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 3023 aa AA seqDB search
MEPFRIIPTRRWLRSSRKAQEVNETGDQLGILGAKPKAASPHPDPNILAKEMEEFEKLMQ
LNSTEGAGSDTKDTTQQNEKGEEPKQAVEADAYVPDQPTTSLEPYEPAQPTTSPVIPSKD
EQTTVSPEAYEPDQPTPVEEVYTPDQQTCVVNDKTAKGPSLQDSAPYEPEQPTDEPMVLQ
DSGVSAKAKTEVSEVEADMPQLQLDSVTCSSDNHGQIEKGGDLATSEDTDATLAQNVFNN
EGGNKSEQENLLPEEWLRKKEKKKKHSHGKHKKPLVEWRLGVLRKDYVIKDFKSFPVDEK
LMATTKHKWNDESEVEHLKFLHSGDGSQTDTSEVSGMTSPAVALSDNELESDQNTSGDIN
SIGRTPENAPEDDGGINSSKDNDIQRVESKCLEGETKKEESGEVEKVLEESASHENVKSG
TGLEDTKPKGDTEIDESSTVEKTEDLGAQKDGDTKEVQKGSVDEEETKKKSEQEEDNSSR
MSTRQSSRRAGRDSGENKTDADHKSDKKDDDSSRRRSRRSERYRDDSDDEKRKDSDRSRT
ESDRTRMDTRRRSQRRDRYGRDDSDDESREGRRRGRSDSRERRGRSGSRERRRYRDDDDR
YDRYDRGRRQRRSDRRSMDRTDDRRSREDDRRNERSVSRERVDRRRKEKDDKDVKKDVDQ
TKEETKVTAEKKTQKADEREGDQLPGNSKADSKITESDTIQEKDQNSKKDTSDKNAGRIP
IKFNFTSRAVRRSTRSAVKAKGGVFEEDEDEDKPLSELQTLCDEKEATVSESEEDQAPPV
TRSKSREGCPVEERLEENKVGQLSSVHTETSTTRARSSQNRENLFENTLRKEFKIDQESE
SDSGAELSLMSLGDAPSLYPENILESQVEMELLANAFSSTDTEAETEIVLDTTGESDNFV
MEGKEEDDSPKQEESDDVDMDVDMEVEEQLHDVSTIVVSSPPHIPDEEGTDTDTDVQLSN
SPSPSPSPRENSRTCSEEMPIAPEEQTRSEIDGNEKQSQNGRLQENKDIIIHETRIVPEI
KIVPAPDESCYQVRSEKAEESTEEKESEINTSFETEQSDVESLSLAKTSDFSKTESESED
AMSMEIIDLMAGTSYKTSKISVNLPNEESDLNTSIQDVSDKIADNDEETICDQTSVMLLE
EVTSVSQPAQPPISDSQDPDVNAETIVLDRSTSDQNITVQGADKAKASSEVVISDELIMP
SIDIVNKSLPSEKGTIEVFNKESAINHDELVETNTMPSSDIPSAQHDDITTQMVPPISAE
STEISSTQEPVIAVNEQPTKHVIQEGPVGSKRKRKSRWAAFVPEVSVKPPTLSQMDVSVV
QTPQGYPSMINMSSNSVFQPQTEEHQIKESRVEVNTPEESKSAHVESHIEEQSVDSPKLE
EETLSPSKRVRVHLDRMVIAAADQLSHDNSTHNMTLDPWVIGKTEATYLSSGLDLEVNGA
GDNQAMIKLEDIAKNHEAGIINEEIEDAGEVMEPQPGAGEDSMEEGELDSDIKEETDEKP
CNDITGMEQGEIDDDGEGGVEERRQKQKSRHSRQDKENIPQNEYWAEEGKREERERPKEE
TRESREERRRLQYAEWGIVERSKMPRFVELNENYYLTERRRSKAGKEARRMVCCCATSRE
ERRRGIQACGEDCLNRVLMLECGSRCPCGDYCTNRRFQKRENARVGVFYTEEKGHGLKAK
EELKDNEFVMEYVGEVLNFHEFKHRAKQYSKDKNLHFYFMALKSDEIIDATEKGNVSRFM
NHSCDPNCETQKWTVNGQLRVGFFTKRQVKPGEELTFDYQFEVYGQEAQKCLCGSEKCRG
VIGKQKKQKEGKDTTPKRRGSFGEKRRKEAFTDITLEDEIQQMVDECDECGLESNDHTIA
LSRFMVRADQPKQRLALLQLLQETTEQAYLKYFLTHHGLKLIWSWMVDLGDSPAELQMQI
LLTLAKLPIPNKNALEDSKVLSVIERWARNFANQGPTQEMTSATKADSDVDSSSASETPS
RSDTPISAAMASSLNVNSSIEMLKSIAEATSSESDMDSETPSGVPLALRQRLEAESMESP
TSTGSEGESMEKPTSSAGEDSQNEQQEDVLLGQPDSASDAATSTTTVEESVSKDKENSLS
ETLAFDSAVVDSTETGLPETTESSDDSSKEVRTLKSLAADATRHVQSQNSSTDAQADVAI
SQSEDIVSESSTSPAEESVMASTSESENRTKDVEQPPSVAVETDNEAESKTDEGEKGGDS
EISIILSSLLSSWSDLKEIYRIPKKESEKDRDKDRERDRHREHDRDRDRKHDRDRDYDRD
HRDRDRDYGRDRDRGRDRDDRHHRDRGRDGDRDRHRDKERKDRDKSDDKSRRKRSRSRSR
ERETKSSWSKDSDTNATPPKLRKPWKDAKGKEGKGVVKEDVKFEKESKKMSKEERRHLFE
MQVEAKEREDAARKEQEAVMMAQWQESEQQRQQQMAQYIDANGFPIDPNAPPHGMMVNEH
GMPIEVIPGHMGGMPPMGEQYMGHHPDMPHPDMAFPPEHMHPDMQGQFPELMQQHEHMGM
EERYHPSMHEHHMMPHEGQPMYDDSGFPIPPQEHMHPGMMGMPPHEGMPPHEGMPHPGAM
PHPGMDYQIHPDMDPNAMVHPHAEHLNMDPHMMGAQLHPNMDVHLLGGQPHPGDPNMYPP
EQHMMQPPVEAVPSQEVHVPQVVPIPAAGVAQVPSQSAPREEDLMPPPMLPVPSRKSKKS
KSQKSAAKSSKTSPPSTTYVAPAAPASSGIPVLSSNVPSSSVVSVNQQGYPIAQAAPGIV
PMAQAPQVLQTPVLPQAPQQAAQTTFTFVTPDGMLVTQTIVPLAATEQGISPHVQPMQQH
QQQMAGVQQQQQQQQPQVTESIPSPPAKPKTAKLPANWKTAQDAEGKVYYYHSVTRQTQW
ELPSWDEDEDDMYDDETGGESNTPTYDEKGRPKTTTALADTSSEAAKRLKEAFRSRMSHH
VVGYLNAYRKPDCKLGRITNTEDFKHLARKLTHGIMAKELKHCRNIEDLEVNENVKHKAK
EYIRKYMGRYGKLYKKDPADTDI
NT seq 9072 nt NT seq  +upstreamnt  +downstreamnt
atggagcctttcagaatcatccctacaaggcgatggctgagaagcagcaggaaagcccaa
gaggtcaacgaaacgggggatcaactgggtattcttggagcgaagcctaaggctgccagc
ccgcatccagatcctaatatcttggcaaaggagatggaagagtttgaaaaactaatgcag
cttaattcaactgaaggagctggttcagacaccaaagacactacccaacagaacgagaag
ggagaggaaccaaaacaagcagtagaggcagatgcatatgttcctgaccagccgaccacc
tctctagaaccctatgaaccagcacagccaacaacatcaccagtgataccttccaaagat
gaacagaccactgtatcacctgaagcatatgaaccagaccaaccaactccagttgaagaa
gtgtacacacctgaccaacaaacctgtgttgtcaatgacaagactgcaaagggtccctca
cttcaagattctgctccctatgagcccgagcagcccaccgatgagccaatggtcttacag
gactctggtgtttctgccaaagctaagacagaggtatcagaagtggaagctgatatgcct
caactccagttagattcagttacgtgtagctctgataatcatggacaaattgaaaaggga
ggggatcttgcaactagcgaagacacggatgcaacactagctcaaaatgtttttaacaat
gaaggtggaaacaaatcagaacaagaaaatctccttcctgaagaatggttgagaaagaag
gaaaaaaagaaaaaacactcgcatggcaagcacaaaaagcccctggttgaatggcgattg
ggcgtactcaggaaggattatgttatcaaagacttcaaaagctttccagtcgacgaaaag
ttgatggctacaacaaagcataaatggaatgatgagagtgaagttgaacacctgaaattt
ctgcattcaggggatgggagtcagaccgacacatctgaagtatcgggtatgacttcacct
gcagttgctcttagtgacaatgaacttgaaagtgatcaaaatacaagtggtgacattaat
tccataggaagaacacctgaaaatgcccccgaggatgatggtggtattaatagttcaaag
gacaatgacattcagcgtgtagaatcaaaatgtttggaaggagagacgaaaaaggaggaa
tccggtgaagtggaaaaggtactggaggagagtgcttcgcatgaaaatgtgaagtcaggt
actggacttgaagacaccaaaccgaaaggagataccgaaattgatgaaagtagtactgtt
gagaaaactgaggatttaggggcacaaaaggatggagatacaaaggaagtgcaaaaaggg
tcagttgatgaggaagaaacaaaaaaaaaatcagaacaggaagaagacaattcaagtagg
atgagcacaagacaatcaagcaggagagcagggagagactctggtgagaataaaacagat
gctgatcacaaaagtgataaaaaggatgatgattccagccgaagaagatcaaggagaagt
gaaagatacagagatgattctgatgatgaaaagagaaaagactctgatagaagtagaaca
gagtcagacagaactagaatggatactaggagacgttcacagagaagagaccgatacggt
agggatgactctgatgatgagagtagagaggggaggaggaggggtaggagtgacagcaga
gaaaggagaggaagaagtggcagcagagaaagaagaaggtatagagatgatgacgacaga
tatgacaggtacgatcgaggacgtaggcagagaaggagtgataggcgaagcatggacaga
acagacgacaggagatccagggaagacgatcgaagaaatgaaagaagtgtctcaagggag
agggttgatcggagaaggaaggaaaaggatgataaagatgtgaagaaagatgtagatcag
accaaggaggaaaccaaagtaactgctgagaagaaaacgcaaaaggcagatgaaagagaa
ggtgaccagttaccaggaaacagcaaagcagattcaaagattacggaaagtgacactatt
caagagaaggaccaaaactccaaaaaagatacctccgataagaatgctgggagaatacct
atcaaattcaatttcacttcaagggcagttcgaaggagtactcgtagtgctgtgaaggca
aagggcggagtatttgaagaggatgaggatgaagataaaccactgtcagaattacagact
ttatgtgatgagaaggaagcaacagtttcagaatcagaagaagatcaagctcctcctgtt
actcgcagtaagagtagagaaggctgtccagtggaagaacggttggaagaaaacaaggtc
ggtcaattatcttctgttcatactgaaacaagcacaaccagagccagaagcagtcagaat
agagaaaatttgtttgagaatactctaaggaaggaattcaaaatagatcaagaatcagaa
tcggatagtggggcagaattgagtttgatgagtcttggagatgccccaagtctttatcct
gaaaatatacttgaaagccaagttgaaatggaactcttggcaaatgcattctcttccact
gatactgaagctgagacagaaattgtactggatacaactggggaaagtgataattttgta
atggaaggaaaggaagaagatgattcaccaaaacaagaagagagtgatgatgttgacatg
gatgttgacatggaagttgaggaacaactgcatgatgtcagtactattgtagtttcttca
cccccacatataccagatgaggaaggtacagatactgatactgatgtacagttgagcaat
agtcctagtcctagtcctagtcctcgggagaacagtagaacttgttctgaagaaatgcca
attgctccagaggaacagaccagatcagagattgatggaaatgagaaacagagccaaaat
ggtcgtcttcaggagaacaaagatattattatccatgaaacgcgtattgttccagagatc
aaaatagtgccagctcccgatgaatcctgttaccaagttcgctccgaaaaagctgaggaa
agtactgaagagaaagaaagtgagataaatacatcatttgaaactgaacaaagtgatgtg
gaaagtctctcactggcgaagacatctgactttagcaaaaccgagtctgaatctgaagat
gcaatgtcaatggaaatcattgacctaatggcaggcacatcatataaaacttcaaagata
tctgttaatttaccaaatgaagagtccgatttgaatacttccattcaagatgtttcagat
aaaattgcagataatgatgaggagacaatatgtgaccagacttctgtaatgttactggaa
gaagtgacatcagtgtcgcagcctgcacaaccacctatcagtgattcccaagatcctgat
gttaacgctgaaacaatcgttcttgaccgcagtactagtgatcaaaatataaccgtccag
ggggcagacaaagccaaagcttcctcagaagttgtcatcagtgatgagttgatcatgccc
tccattgatattgtaaataaatctcttccttctgaaaagggtaccattgaagtatttaac
aaagaatctgccataaatcatgatgaacttgtggaaacaaataccatgccatcatcagac
atcccatctgcccaacatgatgatataaccactcagatggtacctcctatttctgcagaa
agcacagaaatttccagtactcaagaacctgttattgcagtcaatgaacaaccaactaaa
catgttatccaagagggacctgtaggtagtaaacgtaaaaggaagtctagatgggcggca
tttgttccagaggtctcagtaaaaccaccaactctgagtcagatggatgttagtgtagtt
caaaccccacaaggatatccatccatgatcaacatgtccagtaattcagtatttcagcca
cagacagaggaacaccagataaaggaatccagagttgaagtgaacactccagaagaaagc
aaatctgcacatgttgaaagccacatagaagagcagtcggtggactcgcccaagttagaa
gaagaaaccctctccccatcaaagagagtgagggtacatctagatcgtatggttattgca
gctgcagatcaattaagccatgataacagtactcacaacatgacacttgatccatgggtc
attggcaagactgaagctacctacctgtcatctggacttgacctggaggtgaatggtgca
ggggataatcaggcaatgatcaagcttgaggatattgctaaaaaccatgaggcaggtatc
atcaatgaagaaatagaagatgcaggagaggttatggaaccacaacctggggcaggagag
gactccatggaagagggagaactggattctgatatcaaggaggagactgacgagaaacca
tgtaatgatattacgggcatggagcaaggagagatcgacgatgatggtgagggaggggtt
gaagaaaggaggcaaaaacagaagtccagacactcgaggcaggacaaggagaatataccg
cagaacgagtactgggcagaagaaggaaagagagaggagagggaaaggccaaaggaggag
acacgagagagtcgagaagagaggcggcggctgcagtacgcggagtggggaatcgttgag
aggagcaagatgccccgctttgtggagttgaacgagaactactacctgacagaaaggcga
agatcaaaagccggtaaggaagcaaggagaatggtatgctgctgtgctacctctagagag
gaaagaaggcgtggcattcaggcttgtggggaagactgtctcaacagagtcctcatgctt
gaatgtggttcacgatgcccatgtggagattactgtaccaacaggcgtttccaaaaaaga
gagaatgccagagtaggagtcttctacactgaagaaaagggacatggtttgaaagctaaa
gaagaactaaaagataatgagtttgtgatggaatacgttggagaggtgctgaactttcat
gagttcaagcatcgagccaagcagtacagcaaagacaagaacctacacttctattttatg
gcgctcaagtccgacgagatcatcgatgctaccgagaaagggaatgtatcgagattcatg
aaccacagctgcgatcctaactgtgaaacacagaagtggacagtgaacggtcagcttcga
gtcggatttttcaccaagaggcaggtcaaacccggggaagagcttacgtttgactaccag
tttgaagtttatggtcaagaagctcagaagtgtctgtgtggatctgagaagtgcaggggt
gtgattggcaagcagaagaaacagaaggaaggcaaagatacaacacctaagagaagaggc
agttttggagagaaacgaaggaaagaagctttcacagatatcacgttggaagatgagata
cagcagatggtagatgagtgtgatgaatgtgggttggaatccaatgaccacaccatcgca
ctctcaaggttcatggttagagctgatcaacccaaacagaggcttgcacttctacaattg
ctacaggaaacaactgagcaggcttacttgaaatacttcctaacccatcatggtcttaag
ctgatatggagctggatggttgacttgggagatagccctgctgaactgcaaatgcagatc
ctcctcaccttagcgaagcttcctataccaaacaagaatgcattggaagacagcaaggtt
ctctcggtcattgagaggtgggctagaaactttgccaaccaaggaccaacccaagaaatg
acatctgcaaccaaggctgacagtgacgttgactcgtccagtgcaagcgagacaccttca
cgatcagatacgcccatttcagctgccatggcatcaagtctgaatgtcaacagtagtatt
gagatgctcaagtcgatagcagaagcaacaagctctgaaagtgatatggacagtgaaaca
ccttcaggagtacctcttgccctccggcaaaggctagaagcagagagcatggaatctcca
acttccactggtagtgaaggagaatccatggaaaaaccaacgtcaagtgcaggagaggat
tctcagaatgagcaacaggaggatgtgttgctagggcaaccagactcggcatcagatgct
gcgacatctactaccacagtggaagaatcagtgagcaaggacaaggaaaattcattgagt
gaaacactagcttttgatagtgctgttgttgatagcacagaaacaggccttccagaaacc
acagaatcgtctgacgatagttccaaggaagttaggacgctcaaatcattagctgcagat
gcaacaagacacgtgcaatctcaaaactcttcaactgatgctcaggcagatgtagcaatc
tcacaatcagaggatattgttagcgagtcctcaacgtcacctgcagaagaatctgtaatg
gccagtacatctgagtctgaaaacaggactaaagatgttgagcagccacccagtgtagca
gttgagacggataacgaagcagaaagcaaaaccgatgaaggagaaaagggtggcgattca
gaaatttccatcattctttcatctctattgagctcttggagtgacctaaaagaaatttat
aggataccaaagaaggagagtgaaaaagatagagacaaagacagagaacgagacagacat
cgtgaacatgacagggatagggatcgtaaacatgaccgtgatagggactatgatagagat
catcgagatcgagatcgggattacggaagagacagggataggggtagggacagagacgat
agacatcacagagacagaggtagagatggtgatcgagatcgccatcgagacaaagaaagg
aaagatagagataaaagtgatgataaatcaaggagaaaacgaagtagatcaagaagtaga
gagcgagagaccaaatcatcttggtctaaggattctgacactaatgctacacctccaaag
ctcaggaaaccatggaaggatgctaaaggaaaggaaggcaagggagtggttaaagaggat
gtgaaatttgagaaggaaagcaaaaaaatgagcaaagaagagaggagacatttatttgaa
atgcaggtggaagcgaaggaaagggaagatgcggctcgtaaagagcaagaggctgtgatg
atggcacaatggcaggagagtgagcagcagagacagcagcaaatggctcagtacatcgat
gctaacggcttccctatagaccccaatgctcctcctcatggtatgatggtcaatgaacat
ggtatgcccatcgaggtcatacctgggcacatgggtggtatgccgccgatgggggagcag
tacatgggacatcatccagacatgcctcatcctgacatggccttcccaccagaacacatg
catccagacatgcaagggcagtttcctgaactcatgcagcaacatgaacacatgggcatg
gaggaaaggtaccacccatccatgcatgaacatcacatgatgcctcatgaaggacagcct
atgtacgatgatagcgggtttccaatcccacctcaagaacacatgcatccagggatgatg
ggtatgccgccccatgaagggatgccaccccatgaaggaatgccacaccccggagcgatg
ccacaccccggtatggactaccaaatccaccctgacatggatcctaatgccatggtgcac
cctcatgccgagcatctcaatatggacccacacatgatgggggcacaactccatcctaac
atggacgttcacctgttagggggtcagccccatccaggagaccctaatatgtatcctcca
gaacaacacatgatgcaacctccggtggaagctgtaccctctcaggaggtgcatgttcca
caggtggtacccattcctgcggcaggagttgcccaggtaccgagccaatctgcaccgcgt
gaggaagatttgatgcctccacccatgttaccggtcccaagtcggaaatcaaagaagtct
aaatcacagaagagtgcagccaagtcctccaagacgagccctccctctaccacctatgtc
gcccctgctgcacctgccagcagtggcattccagtactatcatcaaacgtaccctcttcc
agtgtggttagtgtgaaccaacagggctaccccattgcccaggctgcaccagggatcgtc
ccaatggcccaggcaccacaagtcttgcaaacgccagtactacctcaagcacctcagcaa
gctgcccaaacgaccttcaccttcgtaactcctgacggcatgctggtgactcagaccatc
gttcctctcgctgctacggagcagggcatctcacctcatgtacagcccatgcaacaacac
caacaacaaatggctggagtgcaacaacaacaacagcagcaacaaccacaggttacagag
tctatcccttcaccccctgcgaaaccaaagactgccaagcttcctgctaactggaagaca
gcccaggacgcagaaggaaaagtctattactaccactctgttacaagacaaacccagtgg
gagttgccctcttgggacgaggatgaagatgatatgtatgatgacgagacaggtggagaa
tctaacacacctacatacgatgagaagggtagaccgaaaaccactactgctcttgctgat
acttcctctgaagctgccaagaggctcaaggaggcattcagatcaaggatgtcccatcat
gttgttggctatctcaacgcctaccgcaaaccagactgtaagctgggccgcatcaccaac
acggaagacttcaagcatctggctaggaagctaacccacggcatcatggccaaggagctg
aagcactgcagaaacatcgaggatctagaggtcaacgagaacgtcaaacataaagccaaa
gaatacatcaggaagtacatgggacgctatgggaagctctacaagaaagatccagccgac
accgatatttga

DBGET integrated database retrieval system