KEGG   Strongylocentrotus purpuratus (purple sea urchin): 586977Help
Entry
586977            CDS       T01019                                 

Definition
(RefSeq) superoxide dismutase [Mn], mitochondrial
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
FoxO signaling pathway
Peroxisome
Brite
KEGG Orthology (KO) [BR:spu00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    586977
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    586977
Enzymes [BR:spu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     586977
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Un
AA seq 269 aa AA seqDB search
MASACYVDSKMFAFFIILWMCTTSYCVSYPFECIAEIRSEYILPDLPFGYDDLEPYIDSA
TLNVHHRGHHAGYTRKLNAALHQWGSEEPDSYAATSILDLLQHLDDIPPKYKQSIRNNGG
GFVNHNIYWSTMASNKENVTTMPSGDLLGEINESFGSFEEFKNQFTGRALTLFGSGYVWL
SRRKPSSPFEEVEEEPASLIISTTANQDTPISNGLQPILVLDVWEHAYYLKHQNKRANHI
EDWWRVVDWSAVANLRDWWSGDYEVHDEL
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctgcttgctacgttgacagcaaaatgttcgcgtttttcatcattttatggatg
tgcacaacaagttattgtgtttcctatccgtttgagtgtatcgcagaaattagatcagag
tatattctaccagatttaccttttggttatgacgatttagaaccttacattgacagtgca
actttgaacgtacatcatcgcggtcatcatgcaggctatacacgtaaactcaatgcagca
ttgcatcagtgggggagtgaggagccagacagctatgcagcaacatctatcctcgacctg
ttgcagcatcttgatgacataccgcccaaatataaacaaagcatcaggaataacggagga
gggtttgtcaatcataacatctactggtcaacaatggcttcaaacaaggaaaatgtcacc
accatgccctctggagacctcctaggtgagatcaatgagtcctttggaagctttgaagaa
ttcaagaatcagttcactggtcgagcccttaccttgtttggatctggatatgtgtggctt
agccgtcgcaaaccctcatcaccatttgaagaagtggaggaagagcctgcaagtcttatc
atctcgacgactgccaaccaagacacgcccatctcaaacggccttcagccaatcctggtg
ctggatgtctgggaacacgcctactacctgaagcaccagaacaaacgagccaatcacatc
gaggactggtggagggtagtcgactggtcggctgttgccaatttgagagattggtggtct
ggggattatgaggttcatgacgagttgtag

DBGET integrated database retrieval system